| Identification |
| Name: |
Molybdopterin synthase sulfur carrier subunit |
| Synonyms: |
- MPT synthase subunit 1
- Molybdenum cofactor biosynthesis protein D
- Molybdopterin-converting factor small subunit
- Molybdopterin-converting factor subunit 1
- Sulfur carrier protein moaD
|
| Gene Name: |
moaD |
| Enzyme Class: |
Not Available |
| Biological Properties |
| General Function: |
Involved in Mo-molybdopterin cofactor biosynthetic process |
| Specific Function: |
Involved in sulfur transfer in the conversion of molybdopterin precursor Z to molybdopterin |
| Cellular Location: |
Not Available |
| KEGG Pathways: |
|
| KEGG Reactions: |
|
 | + | 2 Sulfur donor | ↔ |  |
| |
|
| SMPDB Reactions: |
|
 | + |  | + | thiocarboxylated small subunit of molybdopterin synthase | → | 4  | + | 2 thiocarboxylated small subunit of molybdopterin synthase | + | Molybdopterin | + |  |
| |
|
| PseudoCyc/BioCyc Reactions: |
|
 | + | 2 Sulfur donor | ↔ |  |
| | |
 | + |  | + | thiocarboxylated small subunit of molybdopterin synthase | → | 4  | + | 2 thiocarboxylated small subunit of molybdopterin synthase | + | Molybdopterin | + |  |
| |
|
| Complex Reactions: |
|
 | + |  | + | 2 MoaD Protein with thiocarboxylate | → | 5  | + | 2 MoaD Protein with carboxylate | + |  |
| | |
IscS with bound sulfur | + | MoaD Protein with bound AMP | + |  | → |  | + | IscS sulfur acceptor protein | + | MoaD Protein with thiocarboxylate | + |  |
| |
|
| Transports: |
Not Available |
| Metabolites: |
|
| GO Classification: |
| Process |
|---|
| cellular metabolic process | | coenzyme biosynthetic process | | coenzyme metabolic process | | cofactor metabolic process | | metabolic process | | Mo-molybdopterin cofactor biosynthetic process | | sulfur metabolic process |
|
| Gene Properties |
| Locus tag: |
PA3917 |
| Strand: |
- |
| Entrez Gene ID: |
879013 |
| Accession: |
NP_252606.1 |
| GI: |
15599112 |
| Sequence start: |
4386357 |
| Sequence End: |
4386608 |
| Sequence Length: |
251 |
| Gene Sequence: |
>PA3917
ATGATCCGCGTGCAGTATTTCGCCCGTTACCGCGAAGCCCTCGGCATCGACGGCGAGCAGTTGAACTGGGACGCCGGGCTGGCGACCCTCGGCGCCTTGCGCCAGCTCCTGGTGGAGCGCGGCGGGGCCTGGGAGCGTACCCTCGGCGAGCAGAACCTGATGTGCGCGCGCAATCAGGAACTGTGCGGCCTCGACGAGCCGTTGCAGGACGGCGACGAAGTCGCCTTCTTCCCCACCGTCACCGGAGGTTGA |
| Protein Properties |
| Protein Residues: |
83 |
| Protein Molecular Weight: |
9.2 kDa |
| Protein Theoretical pI: |
4.12 |
| Hydropathicity (GRAVY score): |
-0.245 |
| Charge at pH 7 (predicted): |
-6.07 |
| Protein Sequence: |
>PA3917
MIRVQYFARYREALGIDGEQLNWDAGLATLGALRQLLVERGGAWERTLGEQNLMCARNQELCGLDEPLQDGDEVAFFPTVTGG |
| References |
| External Links: |
|
| General Reference: |
PaperBLAST - Find papers about PA3917 and its homologs
|