| Identification |
| Name: |
Molybdopterin synthase catalytic subunit |
| Synonyms: |
- MPT synthase subunit 2
- Molybdenum cofactor biosynthesis protein E
- Molybdopterin-converting factor large subunit
- Molybdopterin-converting factor subunit 2
|
| Gene Name: |
moaE |
| Enzyme Class: |
|
| Biological Properties |
| General Function: |
Involved in Mo-molybdopterin cofactor biosynthetic process |
| Specific Function: |
Converts molybdopterin precursor Z to molybdopterin. This requires the incorporation of two sulfur atoms into precursor Z to generate a dithiolene group. The sulfur is provided by moaD |
| Cellular Location: |
Not Available |
| KEGG Pathways: |
|
| KEGG Reactions: |
|
 | + | 2 Sulfur donor | ↔ |  |
| |
|
| SMPDB Reactions: |
|
 | + |  | + | thiocarboxylated small subunit of molybdopterin synthase | → | 4  | + | 2 thiocarboxylated small subunit of molybdopterin synthase | + | Molybdopterin | + |  |
| |
|
| PseudoCyc/BioCyc Reactions: |
|
 | + | 2 Sulfur donor | ↔ |  |
| | |
 | + |  | + | thiocarboxylated small subunit of molybdopterin synthase | → | 4  | + | 2 thiocarboxylated small subunit of molybdopterin synthase | + | Molybdopterin | + |  |
| |
|
| Complex Reactions: |
|
 | + |  | + | 2 MoaD Protein with thiocarboxylate | → | 5  | + | 2 MoaD Protein with carboxylate | + |  |
| |
|
| Transports: |
Not Available |
| Metabolites: |
|
| GO Classification: |
| Process |
|---|
| cellular metabolic process | | coenzyme biosynthetic process | | coenzyme metabolic process | | cofactor metabolic process | | metabolic process | | Mo-molybdopterin cofactor biosynthetic process |
|
| Gene Properties |
| Locus tag: |
PA3916 |
| Strand: |
- |
| Entrez Gene ID: |
878985 |
| Accession: |
NP_252605.1 |
| GI: |
15599111 |
| Sequence start: |
4385900 |
| Sequence End: |
4386352 |
| Sequence Length: |
452 |
| Gene Sequence: |
>PA3916
ATGGCCATCCGCGTCCAGCAGGCCGCTTTCGATCCGGGGCAGGAGCTTAACGCCCTGCATGCGCAGAACGTCGGCATCGGCGCGGTGGTCGGCTTCGTCGGCTACGTGCGCGACTTCAACGACGGTCGCGAGGTCGGCGGGATGTTCCTCGAACATTATCCGGGCATGACCGAGAAGGCCCTCGGCAAGATCGCCGCCGAGGCCGGGCAGCGCTGGCCGCTGCTGCGCCTGGAGATCCTCCACCGCATCGGCCGCCTGGAGCCGGGCGAGCCGATCGTCTTCGTCGGTTGCGCCAGCGCCCACCGGCAGGCGGCGTTCGACGCCTGCAACTTCGTCATGGACTACCTGAAGACCCGCGCGCCGTTCTGGAAGAAGGAAGACACCGCCGAAGGCCCGCGCTGGGTCGAAGGCCGCTGCAGCGACCAGGCCGCCGCGCAGCGCTGGGAGGAGTGA |
| Protein Properties |
| Protein Residues: |
150 |
| Protein Molecular Weight: |
16.7 kDa |
| Protein Theoretical pI: |
6.11 |
| Hydropathicity (GRAVY score): |
-0.283 |
| Charge at pH 7 (predicted): |
-2.14 |
| Protein Sequence: |
>PA3916
MAIRVQQAAFDPGQELNALHAQNVGIGAVVGFVGYVRDFNDGREVGGMFLEHYPGMTEKALGKIAAEAGQRWPLLRLEILHRIGRLEPGEPIVFVGCASAHRQAAFDACNFVMDYLKTRAPFWKKEDTAEGPRWVEGRCSDQAAAQRWEE |
| References |
| External Links: |
|
| General Reference: |
PaperBLAST - Find papers about PA3916 and its homologs
|