| Identification |
| Name: |
DNA-directed RNA polymerase subunit omega |
| Synonyms: |
- RNAP omega subunit
- RNA polymerase omega subunit
- Transcriptase subunit omega
|
| Gene Name: |
rpoZ |
| Enzyme Class: |
|
| Biological Properties |
| General Function: |
Involved in DNA-directed RNA polymerase activity |
| Specific Function: |
Promotes RNA polymerase assembly. Latches the N- and C- terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits |
| Cellular Location: |
Cytoplasmic |
| KEGG Pathways: |
|
| KEGG Reactions: |
|
 | + | RNA | + | RNA | ↔ |  | + | RNA |
| | |
 | + | RNA | ↔ |  | + | RNA |
| | |
 | + | RNA | ↔ |  | + | RNA |
| | |
 | + | RNA | ↔ |  | + | RNA |
| | |
Nucleoside triphosphate | + | RNA | ↔ |  |
| |
|
| SMPDB Reactions: |
Not Available |
| PseudoCyc/BioCyc Reactions: |
|
 | + | RNA | + | RNA | ↔ |  | + | RNA |
| | |
 | + | RNA | ↔ |  | + | RNA |
| | |
 | + | RNA | ↔ |  | + | RNA |
| | |
 | + | RNA | ↔ |  | + | RNA |
| | |
Nucleoside triphosphate | + | RNA(n) | → |  | + | RNA(n+1) |
| | |
Nucleoside triphosphate | + | RNA | ↔ |  |
| |
|
| Complex Reactions: |
|
Nucleoside triphosphate | + | RNA(n) | → |  | + | RNA(n+1) |
| |
|
| Transports: |
Not Available |
| Metabolites: |
|
| GO Classification: |
| Function |
|---|
| binding | | catalytic activity | | DNA binding | | DNA-directed RNA polymerase activity | | nucleic acid binding | | nucleotidyltransferase activity | | RNA polymerase activity | | transferase activity | | transferase activity, transferring phosphorus-containing groups | | Process |
|---|
| biosynthetic process | | cellular macromolecule biosynthetic process | | macromolecule biosynthetic process | | metabolic process | | transcription | | transcription, DNA-dependent |
|
| Gene Properties |
| Locus tag: |
PA5337 |
| Strand: |
+ |
| Entrez Gene ID: |
878048 |
| Accession: |
NP_254024.1 |
| GI: |
15600530 |
| Sequence start: |
6005899 |
| Sequence End: |
6006165 |
| Sequence Length: |
266 |
| Gene Sequence: |
>PA5337
ATGGCCCGCGTCACCGTTGAAGACTGCCTGGACAACGTCGATAACCGTTTCGAGCTGGTCATGCTCGCCACCAAGCGCGCCCGTCAGCTGGCTACCGGCGGCAAGGAGCCGAAAGTGGCCTGGGAAAACGACAAGCCGACCGTCGTCGCCCTGCGCGAGATCGCTTCCGGCCTGGTCGATGAGAACGTCGTCCAGCAGGAAGACATCGTCGAGGACGAACCGCTGTTCGCAGCGTTCGACGACGAGGCCAACACCGAGGCCCTGTAA |
| Protein Properties |
| Protein Residues: |
88 |
| Protein Molecular Weight: |
9.8 kDa |
| Protein Theoretical pI: |
3.95 |
| Hydropathicity (GRAVY score): |
-0.309 |
| Charge at pH 7 (predicted): |
-11.03 |
| Protein Sequence: |
>PA5337
MARVTVEDCLDNVDNRFELVMLATKRARQLATGGKEPKVAWENDKPTVVALREIASGLVDENVVQQEDIVEDEPLFAAFDDEANTEAL |
| References |
| External Links: |
|
| General Reference: |
PaperBLAST - Find papers about PA5337 and its homologs
|