
Glutaredoxin-3 (PA5129)
| Identification | |||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Name: | Glutaredoxin-3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Synonyms: |
| ||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Name: | grxC | ||||||||||||||||||||||||||||||||||||||||||||||||
| Enzyme Class: | Not Available | ||||||||||||||||||||||||||||||||||||||||||||||||
| Biological Properties | |||||||||||||||||||||||||||||||||||||||||||||||||
| General Function: | Involved in electron carrier activity | ||||||||||||||||||||||||||||||||||||||||||||||||
| Specific Function: | The disulfide bond functions as an electron carrier in the glutathione-dependent synthesis of deoxyribonucleotides by the enzyme ribonucleotide reductase. In addition, it is also involved in reducing some disulfides in a coupled system with glutathione reductase | ||||||||||||||||||||||||||||||||||||||||||||||||
| Cellular Location: | Not Available | ||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG Pathways: |
| ||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG Reactions: | Not Available | ||||||||||||||||||||||||||||||||||||||||||||||||
| SMPDB Reactions: | Not Available | ||||||||||||||||||||||||||||||||||||||||||||||||
| PseudoCyc/BioCyc Reactions: |
| ||||||||||||||||||||||||||||||||||||||||||||||||
| Complex Reactions: |
| ||||||||||||||||||||||||||||||||||||||||||||||||
| Transports: | Not Available | ||||||||||||||||||||||||||||||||||||||||||||||||
| Metabolites: |
| ||||||||||||||||||||||||||||||||||||||||||||||||
| GO Classification: |
| ||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Properties | |||||||||||||||||||||||||||||||||||||||||||||||||
| Locus tag: | PA5129 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Strand: | - | ||||||||||||||||||||||||||||||||||||||||||||||||
| Entrez Gene ID: | 877828 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Accession: | NP_253816.1 | ||||||||||||||||||||||||||||||||||||||||||||||||
| GI: | 15600322 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence start: | 5777134 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence End: | 5777388 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence Length: | 254 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Sequence: |
>PA5129 ATGCCGCCCGTCGTGATCTACACCACCGCCTGGTGTCCGTACTGCATCCGCGCCAAGCAGTTGCTGCAACGCAAGGGCGTGGACTTCCAGGAGATCGCCTGCGACGGCAAGCCCGAACTGCGCGCCGAGCTGGCACGCAAGGCGGGATCGACCACCGTGCCGCAGATCTGGATCGGCGAGACCCATGTCGGCGGCTGCGACGACCTTCATGCACTGGAGCGCGCCGGCAAGCTGGACGCGCTGCTGTCTGCCTGA | ||||||||||||||||||||||||||||||||||||||||||||||||
| Protein Properties | |||||||||||||||||||||||||||||||||||||||||||||||||
| Protein Residues: | 84 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Protein Molecular Weight: | 9.2 kDa | ||||||||||||||||||||||||||||||||||||||||||||||||
| Protein Theoretical pI: | 7.29 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Hydropathicity (GRAVY score): | -0.087 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Charge at pH 7 (predicted): | 0.34 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Protein Sequence: |
>PA5129 MPPVVIYTTAWCPYCIRAKQLLQRKGVDFQEIACDGKPELRAELARKAGSTTVPQIWIGETHVGGCDDLHALERAGKLDALLSA | ||||||||||||||||||||||||||||||||||||||||||||||||
| References | |||||||||||||||||||||||||||||||||||||||||||||||||
| External Links: |
| ||||||||||||||||||||||||||||||||||||||||||||||||
| General Reference: | PaperBLAST - Find papers about PA5129 and its homologs | ||||||||||||||||||||||||||||||||||||||||||||||||