| Identification |
| Name: |
Galactitol permease IIC component |
| Synonyms: |
- EIIC-Gat
- PTS system galactitol-specific EIIC component
|
| Gene Name: |
gatC |
| Enzyme Class: |
Not Available |
| Biological Properties |
| General Function: |
Involved in phosphoenolpyruvate-dependent sugar phosphotransferase system |
| Specific Function: |
The phosphoenolpyruvate-dependent sugar phosphotransferase system (PTS), a major carbohydrate active -transport system, catalyzes the phosphorylation of incoming sugar substrates concomitant with their translocation across the cell membrane. This system is involved in galactitol transport |
| Cellular Location: |
Cell inner membrane; Multi-pass membrane protein |
| KEGG Pathways: |
Not Available |
| Transports: | |
|---|
| Transport References: | - Uniprot Consortium (2012). "Reorganizing the protein space at the Universal Protein Resource (UniProt)." Nucleic Acids Res 40:D71-D75. Pubmed: 22102590
|
| KEGG Reactions: |
Not Available |
| SMPDB Reactions: |
Not Available |
| PseudoCyc/BioCyc Reactions: |
|
 | + | Protein N(pi)-phospho-L-histidine | ↔ |  | + | Protein histidine |
| | |
 | + | HPr - phosphorylated | → | Galactose 1-phosphate | + | HPr | + |  |
| | | |
|
| Complex Reactions: |
Not Available |
| Transports: |
|
| Metabolites: |
|
| GO Classification: |
| Component |
|---|
| cell part | | integral to membrane | | intrinsic to membrane | | membrane part | | Process |
|---|
| carbohydrate transport | | establishment of localization | | phosphoenolpyruvate-dependent sugar phosphotransferase system | | transport |
|
| Gene Properties |
| Locus tag: |
PA4482 |
| Strand: |
+ |
| Entrez Gene ID: |
881166 |
| Accession: |
NP_253172.1 |
| GI: |
15599678 |
| Sequence start: |
5013671 |
| Sequence End: |
5013961 |
| Sequence Length: |
290 |
| Gene Sequence: |
>PA4482
ATGGCGCTTGAACGCTCCGACGTGGAAAAAATCGCCCATCTCGCCCGCCTGGGCCTGAGCGAGGCCGATCTTCCGCGCACCACCGAGACCCTGAACAACATCCTCGGCCTGATCGACCAGATGCAGGCGGTCGACACCAGCGGCGTCGAACCGCTCGCCCATCCGCTGGAAGCCACCCAGCGCCTGCGCCCGGACGCGGTCACCGAGACCGATCACCGCGACGCCTACCAGACCATCGCCCCCGCCGTGGAAGAAGGTCTGTACCTGGTTCCGAAAGTCATCGAGTCATAA |
| Protein Properties |
| Protein Residues: |
96 |
| Protein Molecular Weight: |
10.5 kDa |
| Protein Theoretical pI: |
4.3 |
| Hydropathicity (GRAVY score): |
-0.235 |
| Charge at pH 7 (predicted): |
-8.29 |
| Protein Sequence: |
>PA4482
MALERSDVEKIAHLARLGLSEADLPRTTETLNNILGLIDQMQAVDTSGVEPLAHPLEATQRLRPDAVTETDHRDAYQTIAPAVEEGLYLVPKVIES |
| References |
| External Links: |
|
| General Reference: |
PaperBLAST - Find papers about PA4482 and its homologs
|