| Identification |
| Name: |
6-carboxy-5,6,7,8-tetrahydropterin synthase |
| Synonyms: |
- CPH4 synthase
- Queuosine biosynthesis protein queD
|
| Gene Name: |
queD |
| Enzyme Class: |
|
| Biological Properties |
| General Function: |
Coenzyme transport and metabolism |
| Specific Function: |
Catalyzes the conversion of 7,8-dihydroneopterin triphosphate (H2NTP) to 6-carboxy-5,6,7,8-tetrahydropterin (CPH4) and acetaldehyde. Can also convert 6-pyruvoyltetrahydropterin (PPH4) and sepiapterin to CPH4; these 2 compounds are probably intermediates in the reaction from H2NTP |
| Cellular Location: |
Not Available |
| KEGG Pathways: |
|
| KEGG Reactions: |
|
| SMPDB Reactions: |
|
| PseudoCyc/BioCyc Reactions: |
|
| Complex Reactions: |
|
| Transports: |
Not Available |
| Metabolites: |
|
| GO Classification: |
| Function |
|---|
| 6-pyruvoyltetrahydropterin synthase activity | | binding | | carbon-oxygen lyase activity | | carbon-oxygen lyase activity, acting on phosphates | | catalytic activity | | cation binding | | ion binding | | lyase activity | | metal ion binding | | Process |
|---|
| biosynthetic process | | cellular biosynthetic process | | heterocycle biosynthetic process | | metabolic process | | pteridine and derivative biosynthetic process | | tetrahydrobiopterin biosynthetic process |
|
| Gene Properties |
| Locus tag: |
PA2666 |
| Strand: |
+ |
| Entrez Gene ID: |
882375 |
| Accession: |
NP_251356.1 |
| GI: |
15597862 |
| Sequence start: |
3015582 |
| Sequence End: |
3015938 |
| Sequence Length: |
356 |
| Gene Sequence: |
>PA2666
GTGGAACTCTTCAAAGAATTCACCTTCGAATCCGCCCATCGCCTGCCCCACGTCCCCGAAGGCCACAAATGCGGGCGCCTGCACGGCCACTCGTTCCGTGTCGCCATCCACATCGAAGGCGAGGTCGATCCGCATACCGGCTGGATCCGCGACTTCGCGGAAATCAAGGCGATCTTCAAGCCGATCTACGAGCAACTCGACCACAATTATCTGAACGATATTCCAGGCCTGGAAAACCCCACCAGCGAAAACCTCTGCCGCTGGATCTGGCAACAACTCAAGCCGCTGTTGCCGGAACTCTCCAAGGTCCGCGTCCACGAAACTTGCACCAGCGGTTGCGAATATCGGGGCGATTGA |
| Protein Properties |
| Protein Residues: |
118 |
| Protein Molecular Weight: |
13.8 kDa |
| Protein Theoretical pI: |
6.41 |
| Hydropathicity (GRAVY score): |
-0.545 |
| Charge at pH 7 (predicted): |
-2.97 |
| Protein Sequence: |
>PA2666
MELFKEFTFESAHRLPHVPEGHKCGRLHGHSFRVAIHIEGEVDPHTGWIRDFAEIKAIFKPIYEQLDHNYLNDIPGLENPTSENLCRWIWQQLKPLLPELSKVRVHETCTSGCEYRGD |
| References |
| External Links: |
|
| General Reference: |
PaperBLAST - Find papers about PA2666 and its homologs
|