Anaerobic nitric oxide reductase flavorubredoxin (PA5351)

Identification
Name: Anaerobic nitric oxide reductase flavorubredoxin
Synonyms:
  • FlRd
  • FlavoRb
Gene Name: norV
Enzyme Class: Not Available
Biological Properties
General Function: Involved in iron ion binding
Specific Function: Anaerobic nitric oxide reductase; uses NADH to detoxify nitric oxide (NO), protecting several 4Fe-4S NO-sensitive enzymes. Has at least 2 reductase partners, only one of which (NorW, flavorubredoxin reductase) has been identified. NO probably binds to the di-iron center; electrons enter from the reductase at rubredoxin and are transferred sequentially to the FMN center and the di-iron center. Also able to function as an aerobic oxygen reductase
Cellular Location: Cytoplasm
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions:
    Thumb+Thumb+2 Thumb → Thumb+Thumb+Thumb
    Hydrogen ion + NADH + 2 Nitric oxide → Water + Nitrous oxide + NAD
    ReactionCard
    Transports: Not Available
    Metabolites:
    PAMDB IDNameView
    PAMDB001633Hydrogen ionMetaboCard
    PAMDB000197NADMetaboCard
    PAMDB000398NADHMetaboCard
    PAMDB000495Nitric oxideMetaboCard
    PAMDB001663Nitrous oxideMetaboCard
    PAMDB000142WaterMetaboCard
    GO Classification:
    Function
    binding
    catalytic activity
    cation binding
    electron carrier activity
    FMN binding
    hydrolase activity
    ion binding
    metal ion binding
    nucleotide binding
    oxidoreductase activity
    Gene Properties
    Locus tag: PA5351
    Strand: -
    Entrez Gene ID: 879562
    Accession: NP_254038.1
    GI: 15600544
    Sequence start: 6019181
    Sequence End: 6019348
    Sequence Length: 167
    Gene Sequence: 
    >PA5351
ATGAAGAAGTGGCAATGCGTGGTGTGTGGACTGATCTATGACGAGGCCAAAGGCTGGCCGGAAGAAGGCATCGAGGCGGGAACGCGCTGGGAAGACGTGCCTGAAGACTGGCTGTGCCCCGACTGCGGCGTCGGCAAGCTGGACTTCGAGATGATCGAAATCGGCTGA
    Protein Properties
    Protein Residues: 55
    Protein Molecular Weight: 6.3 kDa
    Protein Theoretical pI: 3.87
    Hydropathicity (GRAVY score): -0.289
    Charge at pH 7 (predicted): -8.13
    Protein Sequence: 
    >PA5351
MKKWQCVVCGLIYDEAKGWPEEGIEAGTRWEDVPEDWLCPDCGVGKLDFEMIEIG
    References
    External Links:
    Resource Link
    Genome ID: PA5351
    Entrez Gene ID: 879562
    NCBI Protein ID: 15600544
    General Reference: PaperBLAST - Find papers about PA5351 and its homologs