Identification |
Name: |
Biotin carboxyl carrier protein of acetyl-CoA carboxylase |
Synonyms: |
|
Gene Name: |
accB |
Enzyme Class: |
Not Available |
Biological Properties |
General Function: |
Involved in acetyl-CoA carboxylase activity |
Specific Function: |
This protein is a component of the acetyl coenzyme A carboxylase complex; first, biotin carboxylase catalyzes the carboxylation of the carrier protein and then the transcarboxylase transfers the carboxyl group to form malonyl-CoA |
Cellular Location: |
Not Available |
KEGG Pathways: |
|
KEGG Reactions: |
| | | | |
 | + | Carboxybiotin-carboxyl-carrier protein | ↔ |  | + | Holo-[carboxylase] |
| |
|
SMPDB Reactions: |
|
 | + |  | + |  | → | Adenosine diphosphate | + |  | + |  | + | Malonyl-CoA | + |  | + |  |
| | |
a biotinylated [BCCP dimer] | + |  | + |  | → | carboxylated-biotinylated [BCCP dimer] | + |  | + |  | + |  |
| |
|
PseudoCyc/BioCyc Reactions: |
|
Complex Reactions: |
Not Available |
Transports: |
Not Available |
Metabolites: |
|
GO Classification: |
Component |
---|
acetyl-CoA carboxylase complex | macromolecular complex | protein complex | Function |
---|
acetyl-CoA carboxylase activity | binding | biotin binding | catalytic activity | CoA carboxylase activity | ligase activity | ligase activity, forming carbon-carbon bonds | vitamin binding | Process |
---|
carboxylic acid metabolic process | cellular metabolic process | fatty acid biosynthetic process | fatty acid metabolic process | metabolic process | monocarboxylic acid metabolic process | organic acid metabolic process | oxoacid metabolic process |
|
Gene Properties |
Locus tag: |
PA4847 |
Strand: |
+ |
Entrez Gene ID: |
879557 |
Accession: |
NP_253534.1 |
GI: |
15600040 |
Sequence start: |
5442304 |
Sequence End: |
5442774 |
Sequence Length: |
470 |
Gene Sequence: |
>PA4847
ATGGACATTCGTAAAGTCAAGAAACTGATCGAGCTGCTGGAAGAGTCCGGTATCGACGAGCTGGAAATCCGCGAAGGCGAAGAGTCGGTACGCATCAGCCGCCACAGCAAGACCGCCGCCCAGCCGGTGTACGCACAGGCTCCGGCCTTCGCCGCTCCGGTCGCCGCGCCGGCGCCGGCAGCCGCCGCTCCGGCCGCCGCTGCCGCGGAAAGCGCCCCGGCCGCTCCGAAGCTGAACGGCAACGTGGTTCGCTCGCCGATGGTCGGCACCTTCTACCGCGCCGCCTCGCCGACCTCGGCCAACTTCGTCGAAGTCGGCCAGAGCGTGAAGAAAGGCGACATCCTGTGCATCGTCGAAGCCATGAAGATGATGAACCACATCGAAGCCGAAGTTAGCGGCACCATCGAGTCGATCCTGGTGGAGAACGGCCAGCCGGTTGAGTTCGACCAGCCGCTGTTCACCATCGTCTAA |
Protein Properties |
Protein Residues: |
156 |
Protein Molecular Weight: |
16.5 kDa |
Protein Theoretical pI: |
4.67 |
Hydropathicity (GRAVY score): |
0.068 |
Charge at pH 7 (predicted): |
-5.55 |
Protein Sequence: |
>PA4847
MDIRKVKKLIELLEESGIDELEIREGEESVRISRHSKTAAQPVYAQAPAFAAPVAAPAPAAAAPAAAAAESAPAAPKLNGNVVRSPMVGTFYRAASPTSANFVEVGQSVKKGDILCIVEAMKMMNHIEAEVSGTIESILVENGQPVEFDQPLFTIV |
References |
External Links: |
|
General Reference: |
PaperBLAST - Find papers about PA4847 and its homologs
|