| Identification |
| Name: |
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase |
| Synonyms: |
- 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase
- PPPK
- 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
- HPPK
|
| Gene Name: |
folK |
| Enzyme Class: |
|
| Biological Properties |
| General Function: |
Involved in 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase activity |
| Specific Function: |
ATP + 2-amino-4-hydroxy-6-hydroxymethyl-7,8- dihydropteridine = AMP + (2-amino-4-hydroxy-7,8-dihydropteridin-6- yl)methyl diphosphate |
| Cellular Location: |
Not Available |
| KEGG Pathways: |
|
| KEGG Reactions: |
Not Available |
| SMPDB Reactions: |
|
| PseudoCyc/BioCyc Reactions: |
|
| Complex Reactions: |
Not Available |
| Transports: |
Not Available |
| Metabolites: |
| PAMDB ID | Name | View |
|---|
| PAMDB001590 | 6-Hydroxymethyl dihydropterin | MetaboCard | | PAMDB001591 | 6-Hydroxymethyl-dihydropterin pyrophosphate | MetaboCard | | PAMDB000014 | Adenosine monophosphate | MetaboCard | | PAMDB000148 | Adenosine triphosphate | MetaboCard | | PAMDB001633 | Hydrogen ion | MetaboCard |
|
| GO Classification: |
| Function |
|---|
| 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase activity | | catalytic activity | | diphosphotransferase activity | | transferase activity | | transferase activity, transferring phosphorus-containing groups | | Process |
|---|
| cellular aromatic compound metabolic process | | cellular metabolic process | | folic acid and derivative biosynthetic process | | folic acid and derivative metabolic process | | metabolic process |
|
| Gene Properties |
| Locus tag: |
PA4728 |
| Strand: |
+ |
| Entrez Gene ID: |
881616 |
| Accession: |
NP_253416.1 |
| GI: |
15599922 |
| Sequence start: |
5310726 |
| Sequence End: |
5311214 |
| Sequence Length: |
488 |
| Gene Sequence: |
>PA4728
ATGATCCAGCGCGTCTACGTGGCGCTGGGCAGCAACCTGGCCGAACCGCGCGAGCAGATCCAGGCTGCCCTCGATGCCTTCGAGCGGCTTCCCGAGACCCGCCTGGTCGCCGTCTCGCCGCTCTACATCAGCGACCCGCTCGGCCCCGCCGACCAGCCGCGCTTCGTCAACGGCGTGGCGGCCCTCGACACCAACCTGGCGCCGCTCGACCTGCTCGACGCCCTGCAGGCCATCGAACTGGAACAGGGGCGCGTCCGCGACCTGCGCTGGGGTCCGCGCACGCTCGACCTGGACATCCTGCTGTTCGGCGAACAATTGCTCGACCTGCCGCGCCTGAAGGTGCCGCACTACCACATGCAGGCGCGCGCTTTCGTGCTCTATCCCCTCGCCGATCTCGCCCCCGACCTGCGCCTGCCCGATGGCCGCCACCTGCCGGAGCTGCTCGCGGCCTGTCCGTTCGAGGGCATCGAACGCCTTCCGGGCGCCTGA |
| Protein Properties |
| Protein Residues: |
162 |
| Protein Molecular Weight: |
18 kDa |
| Protein Theoretical pI: |
4.56 |
| Hydropathicity (GRAVY score): |
0.035 |
| Charge at pH 7 (predicted): |
-7.31 |
| Protein Sequence: |
>PA4728
MIQRVYVALGSNLAEPREQIQAALDAFERLPETRLVAVSPLYISDPLGPADQPRFVNGVAALDTNLAPLDLLDALQAIELEQGRVRDLRWGPRTLDLDILLFGEQLLDLPRLKVPHYHMQARAFVLYPLADLAPDLRLPDGRHLPELLAACPFEGIERLPGA |
| References |
| External Links: |
|
| General Reference: |
PaperBLAST - Find papers about PA4728 and its homologs
|