NifU-like protein (PA3813)

Identification
Name: NifU-like protein
Synonyms: Not Available
Gene Name: nifU
Enzyme Class: Not Available
Biological Properties
General Function: Involved in iron ion binding
Specific Function: May be involved in the formation or repair of [Fe-S] clusters present in iron-sulfur proteins (Potential)
Cellular Location: Not Available
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Thumb+2 Thumb+IscU with two bound [2Fe-2S] clusters → Thumb+IscU with bound [4Fe-4S] cluster
    FADH2 + 2 Hydrogen ion + IscU with two bound [2Fe-2S] clusters → FAD + IscU with bound [4Fe-4S] cluster
    ReactionCard
    Complex Reactions:
    4 Thumb+IscU with bound [2Fe-2S] cluster → [2Fe-2S] iron-sulfur cluster+IscU scaffold protein
    4 Hydrogen ion + IscU with bound [2Fe-2S] cluster → [2Fe-2S] iron-sulfur cluster + IscU scaffold protein
    ReactionCard
    4 Thumb+IscU with bound [4Fe-4S] cluster → [4Fe-4S] iron-sulfur cluster+IscU scaffold protein
    4 Hydrogen ion + IscU with bound [4Fe-4S] cluster → [4Fe-4S] iron-sulfur cluster + IscU scaffold protein
    ReactionCard
    [2Fe-1S] desulfurated iron-sulfur cluster+IscS with bound sulfur+IscU scaffold protein → 4 Thumb+IscS sulfur acceptor protein+IscU with bound [2Fe-2S] cluster
    [2Fe-1S] desulfurated iron-sulfur cluster + IscS with bound sulfur + IscU scaffold protein → 4 Hydrogen ion + IscS sulfur acceptor protein + IscU with bound [2Fe-2S] cluster
    ReactionCard
    Thumb+2 Thumb+2 IscS with bound sulfur+IscU scaffold protein → Thumb+6 Thumb+2 IscS sulfur acceptor protein+IscU with bound [2Fe-2S] cluster
    FADH2 + 2 Iron + 2 IscS with bound sulfur + IscU scaffold protein → FAD + 6 Hydrogen ion + 2 IscS sulfur acceptor protein + IscU with bound [2Fe-2S] cluster
    ReactionCard
    Thumb+2 Thumb+2 IscS with bound sulfur+IscU with bound [2Fe-2S] cluster → Thumb+6 Thumb+2 IscS sulfur acceptor protein+IscU with two bound [2Fe-2S] clusters
    FADH2 + 2 Iron + 2 IscS with bound sulfur + IscU with bound [2Fe-2S] cluster → FAD + 6 Hydrogen ion + 2 IscS sulfur acceptor protein + IscU with two bound [2Fe-2S] clusters
    ReactionCard
    Thumb+2 Thumb+IscU with two bound [2Fe-2S] clusters → Thumb+IscU with bound [4Fe-4S] cluster
    FADH2 + 2 Hydrogen ion + IscU with two bound [2Fe-2S] clusters → FAD + IscU with bound [4Fe-4S] cluster
    ReactionCard
    Transports: Not Available
    Metabolites:
    PAMDB IDNameView
    PAMDB000308FADMetaboCard
    PAMDB000293FADH2MetaboCard
    PAMDB001633Hydrogen ionMetaboCard
    PAMDB000172IronMetaboCard
    GO Classification:
    Function
    binding
    cation binding
    ion binding
    iron ion binding
    iron-sulfur cluster binding
    metal cluster binding
    metal ion binding
    protein binding
    transition metal ion binding
    Process
    biosynthetic process
    cellular biosynthetic process
    cofactor biosynthetic process
    iron-sulfur cluster assembly
    metabolic process
    metallo-sulfur cluster assembly
    Gene Properties
    Locus tag: PA3813
    Strand: -
    Entrez Gene ID: 879917
    Accession: NP_252502.1
    GI: 15599008
    Sequence start: 4270499
    Sequence End: 4270885
    Sequence Length: 386
    Gene Sequence: 
    >PA3813
ATGGCATATAGCGAAAAGGTCATCGACCACTACGAAAACCCGCGCAACGTCGGCAAGCTCGACGCTGCCGATCCCAACGTCGGCACCGGCATGGTCGGCGCGCCGGCCTGCGGCGACGTGATGCGCCTGCAGATCAAGGTCAACGAGCAGGGCGTGATCGAAGACGCCAAGTTCAAGACCTACGGTTGCGGTTCCGCGATCGCCTCCAGCTCCCTCGCCACCGAGTGGATGAAGGGCAAGACCCTGGACGAGGCGGAAACCATCAAGAACACCACCATCGCCGAAGAGCTGGCCCTGCCGCCGGTGAAGATCCACTGCTCCGTTCTCGCCGAAGACGCCATCAAGGCCGCCGTTCGCGACTACAAGCAGAAGAAGGGTTTGCTCTAA
    Protein Properties
    Protein Residues: 128
    Protein Molecular Weight: 13.8 kDa
    Protein Theoretical pI: 5.77
    Hydropathicity (GRAVY score): -0.238
    Charge at pH 7 (predicted): -1.62
    Protein Sequence: 
    >PA3813
MAYSEKVIDHYENPRNVGKLDAADPNVGTGMVGAPACGDVMRLQIKVNEQGVIEDAKFKTYGCGSAIASSSLATEWMKGKTLDEAETIKNTTIAEELALPPVKIHCSVLAEDAIKAAVRDYKQKKGLL
    References
    External Links:
    Resource Link
    Genome ID: PA3813
    Entrez Gene ID: 879917
    NCBI Protein ID: 15599008
    General Reference: PaperBLAST - Find papers about PA3813 and its homologs