Spermidine export protein mdtI (PA1540)
| Identification | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Name: | Spermidine export protein mdtI | |||||||||
| Synonyms: | Not Available | |||||||||
| Gene Name: | mdtI | |||||||||
| Enzyme Class: | Not Available | |||||||||
| Biological Properties | ||||||||||
| General Function: | Involved in spermidine transmembrane transporter activity | |||||||||
| Specific Function: | Catalyzes the excretion of spermidine. Can also confer resistance to deoxycholate and SDS | |||||||||
| Cellular Location: | Cell inner membrane; Multi-pass membrane protein | |||||||||
| KEGG Pathways: |
| |||||||||
| KEGG Reactions: | Not Available | |||||||||
| SMPDB Reactions: | Not Available | |||||||||
| PseudoCyc/BioCyc Reactions: |
| |||||||||
| Complex Reactions: | Not Available | |||||||||
| Transports: | ||||||||||
| Metabolites: |
| |||||||||
| GO Classification: |
| |||||||||
| Gene Properties | ||||||||||
| Locus tag: | PA1540 | |||||||||
| Strand: | - | |||||||||
| Entrez Gene ID: | 883069 | |||||||||
| Accession: | NP_250231.1 | |||||||||
| GI: | 15596737 | |||||||||
| Sequence start: | 1678261 | |||||||||
| Sequence End: | 1678590 | |||||||||
| Sequence Length: | 329 | |||||||||
| Gene Sequence: |
>PA1540 ATGCTGACCCTGAACTGGATTCCCTTCGCCTGGCTCGGCCTGGCAATCGCCCTCGAGGTCGTCGCCAACCTGCTGTTGAAATACTCCGACGGTTTCCGCAGGCGCGGCCTCGGGATCGCCTCGATCCTCTGCGTGATGGCCGCCTTCACCGCGCTGGCGCAGGCGGTGAAGGACATCGAGCTGTCACTCGCCTATGCGATCTGGGGCGGCTTCGGCATCCTCGCCACCGTCGCCATGGGCTGGGCGCTGTTCGGCCAGCGCCTGGCCTGGCGCGGCTGGCTCGGCCTGTTGCTGCTGCTGGCCGGCATGAGCCTGCTCAAGCTGGCCTGA | |||||||||
| Protein Properties | ||||||||||
| Protein Residues: | 109 | |||||||||
| Protein Molecular Weight: | 11.8 kDa | |||||||||
| Protein Theoretical pI: | 10.32 | |||||||||
| Hydropathicity (GRAVY score): | 1.12 | |||||||||
| Charge at pH 7 (predicted): | 3.95 | |||||||||
| Protein Sequence: |
>PA1540 MLTLNWIPFAWLGLAIALEVVANLLLKYSDGFRRRGLGIASILCVMAAFTALAQAVKDIELSLAYAIWGGFGILATVAMGWALFGQRLAWRGWLGLLLLLAGMSLLKLA | |||||||||
| References | ||||||||||
| External Links: |
| |||||||||
| General Reference: | PaperBLAST - Find papers about PA1540 and its homologs | |||||||||