| Identification |
| Name: |
Threonylcarbamoyl-AMP synthase |
| Synonyms: |
Not Available |
| Gene Name: |
tsaC |
| Enzyme Class: |
|
| Biological Properties |
| General Function: |
threonylcarbamoyladenosine biosynthetic process |
| Specific Function: |
Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Catalyzes the conversion of L-threonine, bicarbonate/CO(2) and ATP to give threonylcarbamoyl-AMP (TC-AMP) as the acyladenylate intermediate, with the release of pyrophosphate. Is also able to catalyze the reverse reaction in vitro, i.e. the formation of ATP from TC-AMP and PPi. Shows higher affinity for the full-length tRNA(Thr) lacking only the t(6)A37 modification than for its fully modified counterpart. Could also be required for the maturation of 16S rRNA. Binds to double-stranded RNA but does not interact tightly with either of the ribosomal subunits, or the 70S particles. |
| Cellular Location: |
Not Available |
| KEGG Pathways: |
Not Available |
| KEGG Reactions: |
|
| SMPDB Reactions: |
Not Available |
| PseudoCyc/BioCyc Reactions: |
|
| Complex Reactions: |
Not Available |
| Transports: |
Not Available |
| Metabolites: |
|
| GO Classification: |
| Function |
|---|
| ATP binding | | cytoplasm | | double-stranded RNA binding | | nucleotidyltransferase activity | | regulation of translational fidelity | | rRNA processing | | threonylcarbamoyladenosine biosynthetic process | | tRNA binding |
|
| Gene Properties |
| Locus tag: |
PA0022 |
| Strand: |
+ |
| Entrez Gene ID: |
880711 |
| Accession: |
NP_248712.1 |
| GI: |
15595220 |
| Sequence start: |
24001 |
| Sequence End: |
24558 |
| Sequence Length: |
557 |
| Gene Sequence: |
>PA0022
ATGATCAGCAGCTTTCGTGCGCAATGCGCCGCCCGGGTCGTCCGCGAGGGCGGCGTGATCGCCTATCCCACCGAGGCGGTATGGGGGCTCGGCTGCGACCCGTGGAACGAGGATGCGGTGTATCGCCTGCTGGCGCTGAAGGCGCGGCCGGTGGAAAAGGGCCTGATCGTGGTGGCGGCGAACATCCACCAGCTCGACTTCCTTCTCGAAGACCTGCCGGACGTCTGGCTGGACCGCCTGGCCGGTACCTGGCCGGGGCCGAACACCTGGCTGGTGCCGCACCAGGAGCGCCTGCCGGAGTGGGTCACCGGCGTCCACGACAGCGTCGCCGTGCGGGTCACCGACCATCCCCTGGTACAGGAACTGTGCCATCTCACCGGTCCGCTGATCTCCACCTCGGCCAATCCGGCCGGGCGCCCGGCGGCGCGCACGCGGCTGCGGGTGGAGCAATACTTCCACGACGAGCTGGACGCTATCCTCGGCGGCGCCCTTGGCGGGCGCCGCAACCCCAGCCTGATCCGCGACCTGGTGACTGGACAGGTCATCCGCCCGGCCTGA |
| Protein Properties |
| Protein Residues: |
185 |
| Protein Molecular Weight: |
20.4 kDa |
| Protein Theoretical pI: |
6.51 |
| Hydropathicity (GRAVY score): |
-0.025 |
| Charge at pH 7 (predicted): |
-1.66 |
| Protein Sequence: |
>PA0022
MISSFRAQCAARVVREGGVIAYPTEAVWGLGCDPWNEDAVYRLLALKARPVEKGLIVVAANIHQLDFLLEDLPDVWLDRLAGTWPGPNTWLVPHQERLPEWVTGVHDSVAVRVTDHPLVQELCHLTGPLISTSANPAGRPAARTRLRVEQYFHDELDAILGGALGGRRNPSLIRDLVTGQVIRPA |
| References |
| External Links: |
|
| General Reference: |
PaperBLAST - Find papers about PA0022 and its homologs
|
