| Identification |
| Name: |
Peptide deformylase |
| Synonyms: |
- PDF
- Polypeptide deformylase
|
| Gene Name: |
def |
| Enzyme Class: |
|
| Biological Properties |
| General Function: |
Involved in iron ion binding |
| Specific Function: |
Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions |
| Cellular Location: |
Cytoplasmic |
| KEGG Pathways: |
Not Available |
| KEGG Reactions: |
|
Formyl-L-methionyl peptide | + |  | ↔ |  | + | Methionyl peptide |
| |
|
| SMPDB Reactions: |
Not Available |
| PseudoCyc/BioCyc Reactions: |
|
| + | formyl-L-methionyl peptide | → |  | + | methionyl peptide | + | |
| |
|
| Complex Reactions: |
|
Formyl-L-methionyl peptide | + | | → | | + | methionyl peptide |
| |
|
| Transports: |
Not Available |
| Metabolites: |
|
| GO Classification: |
| Function |
|---|
| binding | | catalytic activity | | cation binding | | hydrolase activity | | hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds | | hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides | | ion binding | | iron ion binding | | metal ion binding | | peptide deformylase activity | | transition metal ion binding | | Process |
|---|
| biosynthetic process | | cellular macromolecule biosynthetic process | | macromolecule biosynthetic process | | metabolic process | | translation |
|
| Gene Properties |
| Locus tag: |
PA0019 |
| Strand: |
- |
| Entrez Gene ID: |
879306 |
| Accession: |
NP_248709.1 |
| GI: |
15595217 |
| Sequence start: |
21067 |
| Sequence End: |
21573 |
| Sequence Length: |
506 |
| Gene Sequence: |
>PA0019
ATGGCCATCCTGAACATTCTCGAATTCCCCGATCCGCGCCTGCGGACCATCGCCAAACCGGTGGAGGTGGTCGACGACGCGGTGCGCCAGCTGATCGACGACATGTTCGAAACCATGTACGAAGCCCCGGGCATCGGCCTCGCCGCGACCCAGGTGAACGTGCACAAGCGCATCGTGGTCATGGACCTCAGCGAAGACAAGTCCGAGCCGAGGGTATTCATCAACCCCGAGTTCGAACCGCTGACCGAGGATATGGACCAGTACCAGGAAGGCTGCCTGTCGGTACCCGGCTTCTACGAGAACGTGGACCGACCGCAGAAGGTCCGGATCAAGGCCCTCGACCGCGATGGCAACCCCTTCGAGGAAGTCGCCGAAGGCCTGCTGGCGGTATGCATCCAGCACGAATGCGACCACCTCAACGGCAAGCTGTTCGTCGACTACCTGTCCACCCTCAAGCGCGACCGCATCCGCAAGAAGCTGGAAAAGCAGCATCGACAGCAGGCGTGA |
| Protein Properties |
| Protein Residues: |
168 |
| Protein Molecular Weight: |
19.4 kDa |
| Protein Theoretical pI: |
4.73 |
| Hydropathicity (GRAVY score): |
-0.441 |
| Charge at pH 7 (predicted): |
-8.13 |
| Protein Sequence: |
>PA0019
MAILNILEFPDPRLRTIAKPVEVVDDAVRQLIDDMFETMYEAPGIGLAATQVNVHKRIVVMDLSEDKSEPRVFINPEFEPLTEDMDQYQEGCLSVPGFYENVDRPQKVRIKALDRDGNPFEEVAEGLLAVCIQHECDHLNGKLFVDYLSTLKRDRIRKKLEKQHRQQA |
| References |
| External Links: |
|
| General Reference: |
PaperBLAST - Find papers about PA0019 and its homologs
|
