Identification
Name: conserved hypothetical protein
Synonyms: yeaQ
Gene Name: Not Available
Enzyme Class: Not Available
Biological Properties
General Function: Not Available
Specific Function: Not Available
Cellular Location: Cytoplasmic Membrane
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites: Not Available
    GO Classification:
    Component
    integral component of membrane
    Gene Properties
    Locus tag: PA5424
    Strand: -
    Entrez Gene ID: 878439
    Accession: NP_254111.1
    GI: 15600617
    Sequence start: 6104799
    Sequence End: 6105044
    Sequence Length: 245
    Gene Sequence:
    >PA5424
    ATGGGATTAATCGGAACCATCATCGTCGGACTGATCGTTGGTCTCGTTGCACGCTTTCTGAAGCCAGGTGACGACAGCATGGGCTGGATCATGACCATCCTGCTCGGCATCGGCGGTTCGCTGCTGGCCACCTACGGCGGCCAGGCGATCGGCTTCTACCAGGCTGGCCAGGCGGCCGGTTTCATCGGCGCGGTGGTCGGCGCCGTCGTACTGCTGGTCATTTACGGCCTGATCAAGAAGAATTGA
    Protein Properties
    Protein Residues: 81
    Protein Molecular Weight: 8.2 kDa
    Protein Theoretical pI: 9.7
    Hydropathicity (GRAVY score): 1.226
    Charge at pH 7 (predicted): 1.97
    Protein Sequence:
    >PA5424
    MGLIGTIIVGLIVGLVARFLKPGDDSMGWIMTILLGIGGSLLATYGGQAIGFYQAGQAAGFIGAVVGAVVLLVIYGLIKKN
    References
    External Links:
    Resource Link
    Genome ID: PA5424
    Entrez Gene ID: 878439
    NCBI Protein ID: 15600617
    General Reference: PaperBLAST - Find papers about PA5424 and its homologs