Identification
Name: RsmN RNA-binding global regulator CsrA; Uncharacterized protein
Synonyms: Not Available
Gene Name: rsmN
Enzyme Class: Not Available
Biological Properties
General Function: regulation of carbohydrate metabolic process, mRNA catabolic process
Specific Function: RNA binding
Cellular Location: Unknown
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites: Not Available
    GO Classification:
    Function
    RNA binding
    Process
    regulation of carbohydrate metabolic process
    mRNA catabolic process
    Gene Properties
    Locus tag: PA5183.1
    Strand: -
    Entrez Gene ID: 17373387
    Accession: YP_008719784.1
    GI: Not Available
    Sequence start: 5836470
    Sequence End: 5836685
    Sequence Length: 215
    Gene Sequence:
    >PA5183.1
    ATGGGTTTCCTGATACTCTCCCGCCGAGAAGGCGAAGGCATCACCCTGTCCCTCAAGGCCGACTACCCGGCGGAGGAACTGATTCGGCAATTGCGCGAAGGCGGCATCCGGATCCTGGTCACCGATATCATCGGCAACCAGGCCCGGGTCGGGATCGAGGCGCCGCGTGGCGTCCTGATCGTTCGCGACGAGTTGAAAACGGCACCGAAAGGCTGA
    Protein Properties
    Protein Residues: 71
    Protein Molecular Weight: Not Available kDa
    Protein Theoretical pI: Not Available
    Hydropathicity (GRAVY score): Not Available
    Charge at pH 7 (predicted): Not Available
    Protein Sequence:
    >PA5183.1
    MGFLILSRREGEGITLSLKADYPAEELIRQLREGGIRILVTDIIGNQARVGIEAPRGVLIVRDELKTAPKG
    References
    External Links:
    Resource Link
    Genome ID: PA5183.1
    Entrez Gene ID: 17373387
    NCBI Protein ID: Not Available
    General Reference: PaperBLAST - Find papers about PA5183.1 and its homologs