Identification
Name: probable transcriptional regulator
Synonyms: Not Available
Gene Name: Not Available
Enzyme Class: Not Available
Biological Properties
General Function: regulation of transcription, DNA-templated
Specific Function: DNA binding
Cellular Location: Cytoplasmic
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites: Not Available
    GO Classification:
    Function
    DNA binding
    Process
    regulation of transcription, DNA-templated
    Gene Properties
    Locus tag: PA5116
    Strand: +
    Entrez Gene ID: 879600
    Accession: NP_253803.1
    GI: 15600309
    Sequence start: 5762150
    Sequence End: 5762575
    Sequence Length: 425
    Gene Sequence:
    >PA5116
    ATGCGGCAACTGGACATAGGCGAGGTCGCGCGACGATCCGGGGTACCGGCCTCGACCCTGCGCTACTACGAGGAAAAGGGACTGATCGCCTCCAGCGGCCGGCACGGCCTGCGCCGGCTGTTCGATGCAGGCGTGCTGGAGCGGCTGGCGCTGATCGGGCTGGGCCGCGCCGCCGGGTTGTCGCTGGACGAGATTGCCGGCATGGGCGCAGCCGACGGCGCGCTGCGGATCGACCGCGCGGCGCTGGCGGCCAAGGCCGACGAACTGGACCGGACGATCCGCCGCCTCGCCGCCATGCGCGACGGCCTGCGGCATGCCGCGGCCTGTCCGGCGCGCGAGCACATGGACTGCCCGACGTTCCGCCGCTTGCTGCGGGCCGCTGCCGCGGGGGCCATCAAGCCACGCCGGAAAGCGCCCGGCGCATAG
    Protein Properties
    Protein Residues: 141
    Protein Molecular Weight: 15.1 kDa
    Protein Theoretical pI: 11.45
    Hydropathicity (GRAVY score): -0.167
    Charge at pH 7 (predicted): 10.65
    Protein Sequence:
    >PA5116
    MRQLDIGEVARRSGVPASTLRYYEEKGLIASSGRHGLRRLFDAGVLERLALIGLGRAAGLSLDEIAGMGAADGALRIDRAALAAKADELDRTIRRLAAMRDGLRHAAACPAREHMDCPTFRRLLRAAAAGAIKPRRKAPGA
    References
    External Links:
    Resource Link
    Genome ID: PA5116
    Entrez Gene ID: 879600
    NCBI Protein ID: 15600309
    General Reference: PaperBLAST - Find papers about PA5116 and its homologs