
translocation protein TatA (PA5068)
Identification | ||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Name: | translocation protein TatA | |||||||||||||
Synonyms: | yigT; mttA | |||||||||||||
Gene Name: | tatA | |||||||||||||
Enzyme Class: | Not Available | |||||||||||||
Biological Properties | ||||||||||||||
General Function: | protein transport by the Tat complex, protein transport, protein secretion | |||||||||||||
Specific Function: | protein transmembrane transporter activity, protein transporter activity, protein transmembrane transporter activity | |||||||||||||
Cellular Location: | Cytoplasmic Membrane | |||||||||||||
KEGG Pathways: |
| |||||||||||||
KEGG Reactions: | Not Available | |||||||||||||
SMPDB Reactions: | Not Available | |||||||||||||
PseudoCyc/BioCyc Reactions: |
| |||||||||||||
Complex Reactions: | Not Available | |||||||||||||
Transports: | Not Available | |||||||||||||
Metabolites: | Not Available | |||||||||||||
GO Classification: |
| |||||||||||||
Gene Properties | ||||||||||||||
Locus tag: | PA5068 | |||||||||||||
Strand: | + | |||||||||||||
Entrez Gene ID: | 878487 | |||||||||||||
Accession: | NP_253755.1 | |||||||||||||
GI: | 15600261 | |||||||||||||
Sequence start: | 5706552 | |||||||||||||
Sequence End: | 5706800 | |||||||||||||
Sequence Length: | 248 | |||||||||||||
Gene Sequence: |
>PA5068 ATGGGCATTTTTGACTGGAAACACTGGATCGTCATCCTGATCGTCGTGGTACTGGTGTTCGGCACCAAGCGCCTGAAGAACCTCGGTTCCGACGTCGGCGAAGCGATCAAGGGCTTCCGCAAGGCGGTGAACACCGAGGAAGACGACAAGAAGGACCAGCCCGCCGCCCAGCCGGCCCAACCGCTGAACCAGCCGCACACCATCGACGCCCAGGCGCAGAAGGTCGAAGAGCCGGCGCGCAAGGACTGA | |||||||||||||
Protein Properties | ||||||||||||||
Protein Residues: | 82 | |||||||||||||
Protein Molecular Weight: | 9.2 kDa | |||||||||||||
Protein Theoretical pI: | 7.7 | |||||||||||||
Hydropathicity (GRAVY score): | -0.474 | |||||||||||||
Charge at pH 7 (predicted): | 0.47 | |||||||||||||
Protein Sequence: |
>PA5068 MGIFDWKHWIVILIVVVLVFGTKRLKNLGSDVGEAIKGFRKAVNTEEDDKKDQPAAQPAQPLNQPHTIDAQAQKVEEPARKD | |||||||||||||
References | ||||||||||||||
External Links: |
| |||||||||||||
General Reference: | PaperBLAST - Find papers about PA5068 and its homologs |