30S ribosomal protein S18 (PA4934)
Identification | |||||||||
---|---|---|---|---|---|---|---|---|---|
Name: | 30S ribosomal protein S18 | ||||||||
Synonyms: | Not Available | ||||||||
Gene Name: | rpsR | ||||||||
Enzyme Class: | Not Available | ||||||||
Biological Properties | |||||||||
General Function: | translation | ||||||||
Specific Function: | RNA binding, structural constituent of ribosome | ||||||||
Cellular Location: | Cytoplasmic | ||||||||
KEGG Pathways: |
| ||||||||
KEGG Reactions: | Not Available | ||||||||
SMPDB Reactions: | Not Available | ||||||||
PseudoCyc/BioCyc Reactions: |
| ||||||||
Complex Reactions: | Not Available | ||||||||
Transports: | Not Available | ||||||||
Metabolites: | Not Available | ||||||||
GO Classification: |
| ||||||||
Gene Properties | |||||||||
Locus tag: | PA4934 | ||||||||
Strand: | - | ||||||||
Entrez Gene ID: | 878035 | ||||||||
Accession: | NP_253621.1 | ||||||||
GI: | 15600127 | ||||||||
Sequence start: | 5537059 | ||||||||
Sequence End: | 5537289 | ||||||||
Sequence Length: | 230 | ||||||||
Gene Sequence: |
>PA4934 ATGGCACGTTTCTTCCGTCGTCGTAAGTTCTGCCGCTTCACCGCCGAAGGCGTGAAAGAGATCGATTACAAGGATCTCAACACCCTGAAGGCCTACGTTTCCGAAACCGGCAAGATCGTTCCGAGCCGTATCACCGGCACCAAGGCCAAGTACCAGCGTCAGCTGGCGACCGCTATCAAGCGCGCCCGCTACCTGGCCCTGCTTCCTTACACCGACAGCCACGGCCGTTGA | ||||||||
Protein Properties | |||||||||
Protein Residues: | 76 | ||||||||
Protein Molecular Weight: | 8.9 kDa | ||||||||
Protein Theoretical pI: | 11.06 | ||||||||
Hydropathicity (GRAVY score): | -0.607 | ||||||||
Charge at pH 7 (predicted): | 12.19 | ||||||||
Protein Sequence: |
>PA4934 MARFFRRRKFCRFTAEGVKEIDYKDLNTLKAYVSETGKIVPSRITGTKAKYQRQLATAIKRARYLALLPYTDSHGR | ||||||||
References | |||||||||
External Links: |
| ||||||||
General Reference: | PaperBLAST - Find papers about PA4934 and its homologs |