Identification
Name: CueR
Synonyms: ybbI
Gene Name: cueR
Enzyme Class: Not Available
Biological Properties
General Function: regulation of transcription, DNA-templated, positive regulation of transcription, DNA-templated
Specific Function: DNA binding, sequence-specific DNA binding transcription factor activity, copper ion binding, transcription regulatory region DNA binding
Cellular Location: Cytoplasmic
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites: Not Available
    GO Classification:
    Function
    DNA binding
    sequence-specific DNA binding transcription factor activity
    copper ion binding
    transcription regulatory region DNA binding
    Process
    regulation of transcription, DNA-templated
    positive regulation of transcription, DNA-templated
    Gene Properties
    Locus tag: PA4778
    Strand: +
    Entrez Gene ID: 881842
    Accession: NP_253466.1
    GI: 15599972
    Sequence start: 5366257
    Sequence End: 5366655
    Sequence Length: 398
    Gene Sequence:
    >PA4778
    ATGAACATCGGTGAAGCGGCGAAGAAAAGCGGACTGACGCCGAAGATGATCCGTTACTACGAGTCCATCGAGTTGCTCCGCCCAGCCGGACGCAGCGCCAGCGGCTACCGCCACTACAACGAGAACGACCTGCATACCCTGGCGTTCATCCGCCGTTCGCGGGACCTCGGTTTCTCCCTCGACGAAGTCGGCAAGCTGCTCACCCTCTGGCAGGATCGCCAGCGTGCCAGTGCCGACGTCAAGGCCCTGGCGGCGCAGCACGTGCGCGAGCTGAATCGCAAGATCGAGGAGCTCAGCACCCTGCGCGACACCCTGCAGGACCTGGTCGAGCACTGCCAGGGCGACCACCGCCCCGACTGCCCGATCCTCAAGGACCTGGCGTCTGGCTGCTGCCACTGA
    Protein Properties
    Protein Residues: 132
    Protein Molecular Weight: 15 kDa
    Protein Theoretical pI: 7.99
    Hydropathicity (GRAVY score): -0.591
    Charge at pH 7 (predicted): 2.31
    Protein Sequence:
    >PA4778
    MNIGEAAKKSGLTPKMIRYYESIELLRPAGRSASGYRHYNENDLHTLAFIRRSRDLGFSLDEVGKLLTLWQDRQRASADVKALAAQHVRELNRKIEELSTLRDTLQDLVEHCQGDHRPDCPILKDLASGCCH
    References
    External Links:
    Resource Link
    Genome ID: PA4778
    Entrez Gene ID: 881842
    NCBI Protein ID: 15599972
    General Reference: PaperBLAST - Find papers about PA4778 and its homologs