ferric uptake regulation protein (PA4764)

Identification
Name: ferric uptake regulation protein
Synonyms: Not Available
Gene Name: fur
Enzyme Class: Not Available
Biological Properties
General Function: regulation of transcription, DNA-templated, negative regulation of siderophore biosynthetic process, regulation of superoxide dismutase activity, positive regulation of peroxidase activity, negative regulation of lyase activity
Specific Function: sequence-specific DNA binding transcription factor activity, ferrous iron binding, transcription regulatory region DNA binding
Cellular Location: Cytoplasmic
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites: Not Available
    GO Classification:
    Function
    sequence-specific DNA binding transcription factor activity
    ferrous iron binding
    transcription regulatory region DNA binding
    Process
    regulation of transcription, DNA-templated
    negative regulation of siderophore biosynthetic process
    regulation of superoxide dismutase activity
    positive regulation of peroxidase activity
    negative regulation of lyase activity
    Gene Properties
    Locus tag: PA4764
    Strand: -
    Entrez Gene ID: 881780
    Accession: NP_253452.1
    GI: 15599958
    Sequence start: 5351675
    Sequence End: 5352079
    Sequence Length: 404
    Gene Sequence: 
    >PA4764
ATGGTTGAAAATAGCGAACTTCGAAAAGCCGGCCTTAAAGTGACCCTGCCGCGGGTCAAGATCCTGCAGATGCTCGACTCGGCCGAGCAACGCCACATGAGCGCCGAAGACGTGTACAAGGCGCTGATGGAAGCAGGCGAGGACGTGGGCCTGGCAACCGTCTATCGGGTGCTGACCCAGTTCGAGGCCGCCGGCCTGGTGGTGCGTCACAACTTCGATGGCGGCCATGCCGTGTTCGAGCTCGCCGATAGCGGCCACCACGACCACATGGTCTGCGTCGATACCGGCGAGGTGATCGAGTTCATGGATGCGGAAATCGAGAAGCGCCAGAAGGAAATCGTCCGCGAGCGCGGCTTCGAGCTGGTCGATCACAATCTGGTGCTCTACGTGCGCAAGAAGAAGTAG
    Protein Properties
    Protein Residues: 134
    Protein Molecular Weight: 15.2 kDa
    Protein Theoretical pI: 5.87
    Hydropathicity (GRAVY score): -0.262
    Charge at pH 7 (predicted): -4.35
    Protein Sequence: 
    >PA4764
MVENSELRKAGLKVTLPRVKILQMLDSAEQRHMSAEDVYKALMEAGEDVGLATVYRVLTQFEAAGLVVRHNFDGGHAVFELADSGHHDHMVCVDTGEVIEFMDAEIEKRQKEIVRERGFELVDHNLVLYVRKKK
    References
    External Links:
    Resource Link
    Genome ID: PA4764
    Entrez Gene ID: 881780
    NCBI Protein ID: 15599958
    General Reference: PaperBLAST - Find papers about PA4764 and its homologs