
ferric uptake regulation protein (PA4764)
Identification | |||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|
Name: | ferric uptake regulation protein | ||||||||||
Synonyms: | Not Available | ||||||||||
Gene Name: | fur | ||||||||||
Enzyme Class: | Not Available | ||||||||||
Biological Properties | |||||||||||
General Function: | regulation of transcription, DNA-templated, negative regulation of siderophore biosynthetic process, regulation of superoxide dismutase activity, positive regulation of peroxidase activity, negative regulation of lyase activity | ||||||||||
Specific Function: | sequence-specific DNA binding transcription factor activity, ferrous iron binding, transcription regulatory region DNA binding | ||||||||||
Cellular Location: | Cytoplasmic | ||||||||||
KEGG Pathways: |
| ||||||||||
KEGG Reactions: | Not Available | ||||||||||
SMPDB Reactions: | Not Available | ||||||||||
PseudoCyc/BioCyc Reactions: |
| ||||||||||
Complex Reactions: | Not Available | ||||||||||
Transports: | Not Available | ||||||||||
Metabolites: | Not Available | ||||||||||
GO Classification: |
| ||||||||||
Gene Properties | |||||||||||
Locus tag: | PA4764 | ||||||||||
Strand: | - | ||||||||||
Entrez Gene ID: | 881780 | ||||||||||
Accession: | NP_253452.1 | ||||||||||
GI: | 15599958 | ||||||||||
Sequence start: | 5351675 | ||||||||||
Sequence End: | 5352079 | ||||||||||
Sequence Length: | 404 | ||||||||||
Gene Sequence: |
>PA4764 ATGGTTGAAAATAGCGAACTTCGAAAAGCCGGCCTTAAAGTGACCCTGCCGCGGGTCAAGATCCTGCAGATGCTCGACTCGGCCGAGCAACGCCACATGAGCGCCGAAGACGTGTACAAGGCGCTGATGGAAGCAGGCGAGGACGTGGGCCTGGCAACCGTCTATCGGGTGCTGACCCAGTTCGAGGCCGCCGGCCTGGTGGTGCGTCACAACTTCGATGGCGGCCATGCCGTGTTCGAGCTCGCCGATAGCGGCCACCACGACCACATGGTCTGCGTCGATACCGGCGAGGTGATCGAGTTCATGGATGCGGAAATCGAGAAGCGCCAGAAGGAAATCGTCCGCGAGCGCGGCTTCGAGCTGGTCGATCACAATCTGGTGCTCTACGTGCGCAAGAAGAAGTAG | ||||||||||
Protein Properties | |||||||||||
Protein Residues: | 134 | ||||||||||
Protein Molecular Weight: | 15.2 kDa | ||||||||||
Protein Theoretical pI: | 5.87 | ||||||||||
Hydropathicity (GRAVY score): | -0.262 | ||||||||||
Charge at pH 7 (predicted): | -4.35 | ||||||||||
Protein Sequence: |
>PA4764 MVENSELRKAGLKVTLPRVKILQMLDSAEQRHMSAEDVYKALMEAGEDVGLATVYRVLTQFEAAGLVVRHNFDGGHAVFELADSGHHDHMVCVDTGEVIEFMDAEIEKRQKEIVRERGFELVDHNLVLYVRKKK | ||||||||||
References | |||||||||||
External Links: |
| ||||||||||
General Reference: | PaperBLAST - Find papers about PA4764 and its homologs |