Identification
Name: secretion protein SecG preprotein translocase band 1
Synonyms: Not Available
Gene Name: secG
Enzyme Class: Not Available
Biological Properties
General Function: intracellular protein transmembrane transport, intracellular protein transport, protein transport by the Sec complex, protein secretion
Specific Function: P-P-bond-hydrolysis-driven protein transmembrane transporter activity
Cellular Location: Outer Membrane Vesicle
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites: Not Available
    GO Classification:
    Component
    integral component of membrane
    Function
    P-P-bond-hydrolysis-driven protein transmembrane transporter activity
    Process
    intracellular protein transmembrane transport
    intracellular protein transport
    protein transport by the Sec complex
    protein secretion
    Gene Properties
    Locus tag: PA4747
    Strand: -
    Entrez Gene ID: 881707
    Accession: NP_253435.1
    GI: 15599941
    Sequence start: 5332354
    Sequence End: 5332743
    Sequence Length: 389
    Gene Sequence:
    >PA4747
    ATGCTGGAAAAGGTCGTAATTGTCGTGCATCTGCTGATGGCATTGGGTCTTGTTGGCCTGATCCTCGTTCAGCATGGCAAGGGTGCGGATGCAGGGGCTTCTTTCGGTGCAGGTGCTTCGGCAACTGTTTTCGGAAGCCAAGGTTCCGCTACCTTTTTGAGTCGGATTACTGGTATACTGGCAGCGGTTTTTTTCTTGACCAGCCTTGGCTTAGCGTACTTCGCTAAAGAAAAGTCTGATGCTCTGCAACACATCGGACTGCCGGATCCGGCAGTTCTGGAGCAGAAGCAAGAGAAAGCACCGGCCGCTGACGATGTGCCGGTTCTTCAGGAGCAGTCCAAGCCTGCGGAAAGTGCAGGCGATGTACCGGCGGCTCCTGAACAGAAGTAA
    Protein Properties
    Protein Residues: 129
    Protein Molecular Weight: 13.2 kDa
    Protein Theoretical pI: 5.06
    Hydropathicity (GRAVY score): 0.353
    Charge at pH 7 (predicted): -3.29
    Protein Sequence:
    >PA4747
    MLEKVVIVVHLLMALGLVGLILVQHGKGADAGASFGAGASATVFGSQGSATFLSRITGILAAVFFLTSLGLAYFAKEKSDALQHIGLPDPAVLEQKQEKAPAADDVPVLQEQSKPAESAGDVPAAPEQK
    References
    External Links:
    Resource Link
    Genome ID: PA4747
    Entrez Gene ID: 881707
    NCBI Protein ID: 15599941
    General Reference: PaperBLAST - Find papers about PA4747 and its homologs