
30S ribosomal protein S15 (PA4741)
Identification | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|
Name: | 30S ribosomal protein S15 | |||||||||
Synonyms: | Not Available | |||||||||
Gene Name: | rpsO | |||||||||
Enzyme Class: | Not Available | |||||||||
Biological Properties | ||||||||||
General Function: | cellular protein metabolic process, translation | |||||||||
Specific Function: | structural constituent of ribosome, RNA binding | |||||||||
Cellular Location: | Cytoplasmic | |||||||||
KEGG Pathways: |
| |||||||||
KEGG Reactions: | Not Available | |||||||||
SMPDB Reactions: | Not Available | |||||||||
PseudoCyc/BioCyc Reactions: |
| |||||||||
Complex Reactions: | Not Available | |||||||||
Transports: | Not Available | |||||||||
Metabolites: | Not Available | |||||||||
GO Classification: |
| |||||||||
Gene Properties | ||||||||||
Locus tag: | PA4741 | |||||||||
Strand: | - | |||||||||
Entrez Gene ID: | 881675 | |||||||||
Accession: | NP_253429.1 | |||||||||
GI: | 15599935 | |||||||||
Sequence start: | 5325653 | |||||||||
Sequence End: | 5325922 | |||||||||
Sequence Length: | 269 | |||||||||
Gene Sequence: |
>PA4741 ATGGCACTGAGCGTTGAAGAAAAAGCGCAGATCGTTAACGAATACAAGCAAGCTGAAGGCGACACCGGTTCCCCGGAAGTGCAGGTAGCCCTGCTGTCCGCCAACATCAACAAGCTGCAGGATCACTTCAAGGCCAACGGCAAGGATCACCATTCCCGCCGTGGTCTGATCCGTATGGTTAACCAGCGCCGTAAGCTGCTGGACTACCTGAAGGGCAAAGACGTGTCTCGCTACACTGCCCTGATCGGCCGTCTGGGTCTGCGTCGCTAA | |||||||||
Protein Properties | ||||||||||
Protein Residues: | 89 | |||||||||
Protein Molecular Weight: | 10.1 kDa | |||||||||
Protein Theoretical pI: | 10.69 | |||||||||
Hydropathicity (GRAVY score): | -0.683 | |||||||||
Charge at pH 7 (predicted): | 7.7 | |||||||||
Protein Sequence: |
>PA4741 MALSVEEKAQIVNEYKQAEGDTGSPEVQVALLSANINKLQDHFKANGKDHHSRRGLIRMVNQRRKLLDYLKGKDVSRYTALIGRLGLRR | |||||||||
References | ||||||||||
External Links: |
| |||||||||
General Reference: | PaperBLAST - Find papers about PA4741 and its homologs |