suppressor protein DksA (PA4723)

Identification
Name: suppressor protein DksA
Synonyms: Not Available
Gene Name: dksA
Enzyme Class: Not Available
Biological Properties
General Function: response to stimulus, negative regulation of proteolysis, negative regulation of lipid biosynthetic process, positive regulation of transcription regulatory region DNA binding, negative regulation of transcription, DNA-templated, positive regulation of cellular respiration
Specific Function: RNA polymerase binding, zinc ion binding
Cellular Location: Cytoplasmic
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites: Not Available
    GO Classification:
    Function
    RNA polymerase binding
    zinc ion binding
    Process
    response to stimulus
    negative regulation of proteolysis
    negative regulation of lipid biosynthetic process
    positive regulation of transcription regulatory region DNA binding
    negative regulation of transcription, DNA-templated
    positive regulation of cellular respiration
    Gene Properties
    Locus tag: PA4723
    Strand: +
    Entrez Gene ID: 881594
    Accession: NP_253411.1
    GI: 15599917
    Sequence start: 5302386
    Sequence End: 5302832
    Sequence Length: 446
    Gene Sequence: 
    >PA4723
ATGTCCACCAAAGCAAAACAACAGAGCAGCCAGCAGATGACCCGCGGCTTCGAACCCTATCAGGAAACCAAGGGCGAGGAGTACATGAGCGAGCGCATGCGCGCGCACTTCACCGCGATCCTGAACAAATGGAAACAGGAGCTGATGGAAGAGGTCGACCGTACCGTGCATCACATGCAGGACGAAGCGGCCAACTTCCCCGATCCGGCCGACCGCGCCAGCCAGGAAGAAGAATTCAGCCTGGAACTGCGCGCCCGCGACCGCGAGCGCAAGCTGATCAAGAAGATCGACGAGACCCTGCAACTGATCGAAGACGAAGAGTACGGCTGGTGCGACTCCTGCGGCGTCGAGATCGGCATCCGTCGCCTGGAGGCGCGCCCCACCGCGACCCTCTGCATCGACTGCAAGACCCTCGCGGAAATCCGCGAGAAGCAACTCGGCTCCTGA
    Protein Properties
    Protein Residues: 148
    Protein Molecular Weight: 17.3 kDa
    Protein Theoretical pI: 4.77
    Hydropathicity (GRAVY score): -0.959
    Charge at pH 7 (predicted): -7.4
    Protein Sequence: 
    >PA4723
MSTKAKQQSSQQMTRGFEPYQETKGEEYMSERMRAHFTAILNKWKQELMEEVDRTVHHMQDEAANFPDPADRASQEEEFSLELRARDRERKLIKKIDETLQLIEDEEYGWCDSCGVEIGIRRLEARPTATLCIDCKTLAEIREKQLGS
    References
    External Links:
    Resource Link
    Genome ID: PA4723
    Entrez Gene ID: 881594
    NCBI Protein ID: 15599917
    General Reference: PaperBLAST - Find papers about PA4723 and its homologs