
conserved hypothetical protein (PA4605)
| Identification | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Name: | conserved hypothetical protein | ||||||||
| Synonyms: | ybdD | ||||||||
| Gene Name: | Not Available | ||||||||
| Enzyme Class: | Not Available | ||||||||
| Biological Properties | |||||||||
| General Function: | Not Available | ||||||||
| Specific Function: | Not Available | ||||||||
| Cellular Location: | Unknown | ||||||||
| KEGG Pathways: |
| ||||||||
| KEGG Reactions: | Not Available | ||||||||
| SMPDB Reactions: | Not Available | ||||||||
| PseudoCyc/BioCyc Reactions: |
| ||||||||
| Complex Reactions: | Not Available | ||||||||
| Transports: | Not Available | ||||||||
| Metabolites: | Not Available | ||||||||
| GO Classification: | Not Available | ||||||||
| Gene Properties | |||||||||
| Locus tag: | PA4605 | ||||||||
| Strand: | - | ||||||||
| Entrez Gene ID: | 881097 | ||||||||
| Accession: | NP_253295.1 | ||||||||
| GI: | 15599801 | ||||||||
| Sequence start: | 5163536 | ||||||||
| Sequence End: | 5163739 | ||||||||
| Sequence Length: | 203 | ||||||||
| Gene Sequence: |
>PA4605 ATGTTCAACGACCTCAGCCGCATGGGCAAATACCTGGGCCAGGCCGCCCGGATGCTGGTCGGCATGCCCGACTACGACACCTATGTCGAGCACATGCGCAACAAGCACCCGGACAAGCCGGTGATGACCTACGAGGAGTTCTTCCGCGAGCGCCAGGAGGCGCGCTACGGTGGCGGCAAGGGTCGGCCGATCCGCTGCTGCTGA | ||||||||
| Protein Properties | |||||||||
| Protein Residues: | 67 | ||||||||
| Protein Molecular Weight: | 7.9 kDa | ||||||||
| Protein Theoretical pI: | 9.15 | ||||||||
| Hydropathicity (GRAVY score): | -0.936 | ||||||||
| Charge at pH 7 (predicted): | 3.4 | ||||||||
| Protein Sequence: |
>PA4605 MFNDLSRMGKYLGQAARMLVGMPDYDTYVEHMRNKHPDKPVMTYEEFFRERQEARYGGGKGRPIRCC | ||||||||
| References | |||||||||
| External Links: |
| ||||||||
| General Reference: | PaperBLAST - Find papers about PA4605 and its homologs | ||||||||