transcriptional regulator NfxB (PA4600)

Identification
Name: transcriptional regulator NfxB
Synonyms: Not Available
Gene Name: nfxB
Enzyme Class: Not Available
Biological Properties
General Function: regulation of transcription, DNA-templated, negative regulation of transporter activity, negative regulation of transcription, DNA-templated, negative regulation of transporter activity
Specific Function: DNA binding, sequence-specific DNA binding transcription factor activity, transcription regulatory region DNA binding, transcription regulatory region sequence-specific DNA binding
Cellular Location: Cytoplasmic
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites: Not Available
    GO Classification:
    Function
    DNA binding
    sequence-specific DNA binding transcription factor activity
    transcription regulatory region DNA binding
    transcription regulatory region sequence-specific DNA binding
    Process
    regulation of transcription, DNA-templated
    negative regulation of transporter activity
    negative regulation of transcription, DNA-templated
    negative regulation of transporter activity
    Gene Properties
    Locus tag: PA4600
    Strand: +
    Entrez Gene ID: 881079
    Accession: NP_253290.1
    GI: 15599796
    Sequence start: 5155561
    Sequence End: 5156124
    Sequence Length: 563
    Gene Sequence: 
    >PA4600
ATGACCCTGATTTCCCATGACGAGCGACTCATCAAGGCGCTGGCAGTCGCTATCGTCGACCGCCCGCGAGCGACGCTGAAGGAACTGGCCGAGGCGGCCGGCGTAAGCAAGGCCACCCTGCACCGCTTCTGCGGCACGCGGGACAACCTGGTGCAGATGCTCGAGGACCACGGAGAGACCGTACTGAACCAGATCATCCAGGCCTGCGACCTGGAGCATGCCGAGCCTCTGGAGGCGTTGCAGCGCCTGATCAAGGAACACCTCACCCACCGCGAGCTGCTGGTATTCCTGGTATTCCAGTACCGCCCGGACTTCCTCGACCCGCACGGCGAAGGCGCACGCTGGCAGTCCTACCTGGAAGCGCTGGACGCCTTCTTCCTGCGCGGACAGCAGAAAGGCGTGTTTCGCATCGACATCACGGCGGCCGTGTTCACCGAACTGTTCATCACCCTGGTCTACGGCATGGTCGATGCGGAACGTCGCGGACGGGCGGCCAGCTCCAATTCCGCGCATACCCTGGAGCAGATGTTCCTCCATGGCGCCTCCAATCCGGCTCGCTCCTGA
    Protein Properties
    Protein Residues: 187
    Protein Molecular Weight: 21.1 kDa
    Protein Theoretical pI: 6.42
    Hydropathicity (GRAVY score): -0.091
    Charge at pH 7 (predicted): -2.9
    Protein Sequence: 
    >PA4600
MTLISHDERLIKALAVAIVDRPRATLKELAEAAGVSKATLHRFCGTRDNLVQMLEDHGETVLNQIIQACDLEHAEPLEALQRLIKEHLTHRELLVFLVFQYRPDFLDPHGEGARWQSYLEALDAFFLRGQQKGVFRIDITAAVFTELFITLVYGMVDAERRGRAASSNSAHTLEQMFLHGASNPARS
    References
    External Links:
    Resource Link
    Genome ID: PA4600
    Entrez Gene ID: 881079
    NCBI Protein ID: 15599796
    General Reference: PaperBLAST - Find papers about PA4600 and its homologs