Identification
Name: conserved hypothetical protein
Synonyms: Not Available
Gene Name: Not Available
Enzyme Class: Not Available
Biological Properties
General Function: regulation of transcription, DNA-templated
Specific Function: zinc ion binding
Cellular Location: Unknown
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites: Not Available
    GO Classification:
    Function
    zinc ion binding
    Process
    regulation of transcription, DNA-templated
    Gene Properties
    Locus tag: PA4530
    Strand: +
    Entrez Gene ID: 878573
    Accession: NP_253220.1
    GI: 15599726
    Sequence start: 5074172
    Sequence End: 5074372
    Sequence Length: 200
    Gene Sequence:
    >PA4530
    ATGAGCCAGCCCCTGACCGTGGAGTGCCCGACCTGCGGCGCGCCCGTCGAATGGAAAAGCGACAACAAGTACCGCCCCTTCTGCTCCGACCGCTGCAAGCTGATCGATCTCGGCGCCTGGGCCGCCGAGGAACATGCGATCCCCGGCGACACCCTGGAAGACGACATCTTCTCCGCCGACCTGCCGCCTCGCGAGCATTGA
    Protein Properties
    Protein Residues: 66
    Protein Molecular Weight: 7.4 kDa
    Protein Theoretical pI: 4.23
    Hydropathicity (GRAVY score): -0.541
    Charge at pH 7 (predicted): -6.65
    Protein Sequence:
    >PA4530
    MSQPLTVECPTCGAPVEWKSDNKYRPFCSDRCKLIDLGAWAAEEHAIPGDTLEDDIFSADLPPREH
    References
    External Links:
    Resource Link
    Genome ID: PA4530
    Entrez Gene ID: 878573
    NCBI Protein ID: 15599726
    General Reference: PaperBLAST - Find papers about PA4530 and its homologs