| Identification |
| Name: |
conserved hypothetical protein |
| Synonyms: |
piuC |
| Gene Name: |
Not Available |
| Enzyme Class: |
Not Available |
| Biological Properties |
| General Function: |
oxidation-reduction process |
| Specific Function: |
oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors, oxidoreductase activity, iron ion binding, oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, L-ascorbic acid binding |
| Cellular Location: |
Cytoplasmic |
| KEGG Pathways: |
|
| KEGG Reactions: |
Not Available |
| SMPDB Reactions: |
Not Available |
| PseudoCyc/BioCyc Reactions: |
|
| Complex Reactions: |
Not Available |
| Transports: |
Not Available |
| Metabolites: |
Not Available |
| GO Classification: |
| Function |
|---|
| oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors | | oxidoreductase activity | | iron ion binding | | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen | | L-ascorbic acid binding | | Process |
|---|
| oxidation-reduction process |
|
| Gene Properties |
| Locus tag: |
PA4515 |
| Strand: |
+ |
| Entrez Gene ID: |
881121 |
| Accession: |
NP_253205.1 |
| GI: |
15599711 |
| Sequence start: |
5056095 |
| Sequence End: |
5056775 |
| Sequence Length: |
680 |
| Gene Sequence: |
>PA4515
ATGTTGCTGCATATTCCCGCCATCTTCACCGCCGAGGAAGTCTCCCGGATCCGCGCAGCCCTGGAGCAGGCGGAATGGGCCGACGGCAAGGCGACCGCCGGCTACCAATCGGCCAAGGCCAAGCACAACCTGCAACTGCCGCAGGACCACCCGCTGGCCCGGGAGATCGGCGAAGCCATGCTGCAGCGCCTGTGGAACCATCCCCTGTTCATGTCCGCCGCCCTGCCGCTCAAGGTCTTCCCGCCGCTGTTCAACTGCTATACCGGCGGGGGCTCGTTCGACTTCCACATCGACAACGCCGTGCGCGACGTCCATGGCGGCCGCGAGCGGGTCCGTACCGACCTGTCCTCGACCCTCTTCTTCAGCGACCCGGAGGACTATGACGGCGGCGAACTGGTGATCCAAGACACCTACGGCCTGCAACAGGTGAAGCTGCCCGCCGGCGATCTGGTGCTCTACCCCGGCACCAGCCTGCACAAAGTCAATCCGGTCACCCGCGGCGCGCGCTACGCCTCGTTCTTCTGGACCCAGAGCCTGGTCCGCGAAGACAGCCAGCGCACCCTGCTATTCGAAATGGACCAGTCGATCCAGCGACTCACCCGCGACGTCCCCGACCATCCCTCGCTGATCCGCCTCACCGGTACCTACCACAATCTCCTGCGGCGCTGGTCGGAACTCTGA |
| Protein Properties |
| Protein Residues: |
226 |
| Protein Molecular Weight: |
25.6 kDa |
| Protein Theoretical pI: |
6.61 |
| Hydropathicity (GRAVY score): |
-0.337 |
| Charge at pH 7 (predicted): |
-1.87 |
| Protein Sequence: |
>PA4515
MLLHIPAIFTAEEVSRIRAALEQAEWADGKATAGYQSAKAKHNLQLPQDHPLAREIGEAMLQRLWNHPLFMSAALPLKVFPPLFNCYTGGGSFDFHIDNAVRDVHGGRERVRTDLSSTLFFSDPEDYDGGELVIQDTYGLQQVKLPAGDLVLYPGTSLHKVNPVTRGARYASFFWTQSLVREDSQRTLLFEMDQSIQRLTRDVPDHPSLIRLTGTYHNLLRRWSEL |
| References |
| External Links: |
|
| General Reference: |
PaperBLAST - Find papers about PA4515 and its homologs
|