conserved hypothetical protein (PA4515)

Identification
Name: conserved hypothetical protein
Synonyms: piuC
Gene Name: Not Available
Enzyme Class: Not Available
Biological Properties
General Function: oxidation-reduction process
Specific Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors, oxidoreductase activity, iron ion binding, oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, L-ascorbic acid binding
Cellular Location: Cytoplasmic
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites: Not Available
    GO Classification:
    Function
    oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors
    oxidoreductase activity
    iron ion binding
    oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
    L-ascorbic acid binding
    Process
    oxidation-reduction process
    Gene Properties
    Locus tag: PA4515
    Strand: +
    Entrez Gene ID: 881121
    Accession: NP_253205.1
    GI: 15599711
    Sequence start: 5056095
    Sequence End: 5056775
    Sequence Length: 680
    Gene Sequence: 
    >PA4515
ATGTTGCTGCATATTCCCGCCATCTTCACCGCCGAGGAAGTCTCCCGGATCCGCGCAGCCCTGGAGCAGGCGGAATGGGCCGACGGCAAGGCGACCGCCGGCTACCAATCGGCCAAGGCCAAGCACAACCTGCAACTGCCGCAGGACCACCCGCTGGCCCGGGAGATCGGCGAAGCCATGCTGCAGCGCCTGTGGAACCATCCCCTGTTCATGTCCGCCGCCCTGCCGCTCAAGGTCTTCCCGCCGCTGTTCAACTGCTATACCGGCGGGGGCTCGTTCGACTTCCACATCGACAACGCCGTGCGCGACGTCCATGGCGGCCGCGAGCGGGTCCGTACCGACCTGTCCTCGACCCTCTTCTTCAGCGACCCGGAGGACTATGACGGCGGCGAACTGGTGATCCAAGACACCTACGGCCTGCAACAGGTGAAGCTGCCCGCCGGCGATCTGGTGCTCTACCCCGGCACCAGCCTGCACAAAGTCAATCCGGTCACCCGCGGCGCGCGCTACGCCTCGTTCTTCTGGACCCAGAGCCTGGTCCGCGAAGACAGCCAGCGCACCCTGCTATTCGAAATGGACCAGTCGATCCAGCGACTCACCCGCGACGTCCCCGACCATCCCTCGCTGATCCGCCTCACCGGTACCTACCACAATCTCCTGCGGCGCTGGTCGGAACTCTGA
    Protein Properties
    Protein Residues: 226
    Protein Molecular Weight: 25.6 kDa
    Protein Theoretical pI: 6.61
    Hydropathicity (GRAVY score): -0.337
    Charge at pH 7 (predicted): -1.87
    Protein Sequence: 
    >PA4515
MLLHIPAIFTAEEVSRIRAALEQAEWADGKATAGYQSAKAKHNLQLPQDHPLAREIGEAMLQRLWNHPLFMSAALPLKVFPPLFNCYTGGGSFDFHIDNAVRDVHGGRERVRTDLSSTLFFSDPEDYDGGELVIQDTYGLQQVKLPAGDLVLYPGTSLHKVNPVTRGARYASFFWTQSLVREDSQRTLLFEMDQSIQRLTRDVPDHPSLIRLTGTYHNLLRRWSEL
    References
    External Links:
    Resource Link
    Genome ID: PA4515
    Entrez Gene ID: 881121
    NCBI Protein ID: 15599711
    General Reference: PaperBLAST - Find papers about PA4515 and its homologs