conserved hypothetical protein (PA4354)
| Identification | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Name: | conserved hypothetical protein | ||||||||
| Synonyms: | Not Available | ||||||||
| Gene Name: | Not Available | ||||||||
| Enzyme Class: | Not Available | ||||||||
| Biological Properties | |||||||||
| General Function: | regulation of single-species biofilm formation on inanimate substrate, regulation of transcription, DNA-templated | ||||||||
| Specific Function: | transcription regulatory region DNA binding, sequence-specific DNA binding transcription factor activity | ||||||||
| Cellular Location: | Unknown | ||||||||
| KEGG Pathways: |
| ||||||||
| KEGG Reactions: | Not Available | ||||||||
| SMPDB Reactions: | Not Available | ||||||||
| PseudoCyc/BioCyc Reactions: |
| ||||||||
| Complex Reactions: | Not Available | ||||||||
| Transports: | Not Available | ||||||||
| Metabolites: | Not Available | ||||||||
| GO Classification: |
| ||||||||
| Gene Properties | |||||||||
| Locus tag: | PA4354 | ||||||||
| Strand: | + | ||||||||
| Entrez Gene ID: | 881441 | ||||||||
| Accession: | NP_253044.1 | ||||||||
| GI: | 15599550 | ||||||||
| Sequence start: | 4882053 | ||||||||
| Sequence End: | 4882355 | ||||||||
| Sequence Length: | 302 | ||||||||
| Gene Sequence: |
>PA4354 ATGCCACTGGACATCGACGAAATCATCAAGGCTCTCTCCCACCCGGTGCGACGCGACATGCTGCGCTGGCTGAAGGAACCGGAGAAGTACTTCGTCGAGCAGGACCACCCGTTCGAGATCGGCGTCTGCGCCGGCAAGTTCGACCAGCGTACCGGTCTCTCCCAGTCCACCGTATCGGTACACCTCGCCACCCTGCAACGCGCCGGTCTGGTGACCAGCCGCCGGGTCGGCCAGTGGAACTTCTTCAAGCGCAACGAGGAGACCATCCAGGCCTTCCTCGACCAACTCGGCGACGAGCTGTAA | ||||||||
| Protein Properties | |||||||||
| Protein Residues: | 100 | ||||||||
| Protein Molecular Weight: | 11.6 kDa | ||||||||
| Protein Theoretical pI: | 6.25 | ||||||||
| Hydropathicity (GRAVY score): | -0.427 | ||||||||
| Charge at pH 7 (predicted): | -1.32 | ||||||||
| Protein Sequence: |
>PA4354 MPLDIDEIIKALSHPVRRDMLRWLKEPEKYFVEQDHPFEIGVCAGKFDQRTGLSQSTVSVHLATLQRAGLVTSRRVGQWNFFKRNEETIQAFLDQLGDEL | ||||||||
| References | |||||||||
| External Links: |
| ||||||||
| General Reference: | PaperBLAST - Find papers about PA4354 and its homologs | ||||||||