Identification
Name: secretion protein SecE
Synonyms: prlG
Gene Name: secE
Enzyme Class: Not Available
Biological Properties
General Function: protein transport, protein targeting, intracellular protein transport, protein secretion
Specific Function: P-P-bond-hydrolysis-driven protein transmembrane transporter activity
Cellular Location: Cytoplasmic Membrane
KEGG Pathways:
KEGG Reactions: Not Available
SMPDB Reactions: Not Available
PseudoCyc/BioCyc Reactions:
Complex Reactions: Not Available
Transports: Not Available
Metabolites: Not Available
GO Classification:
Component
membrane
integral component of membrane
Function
P-P-bond-hydrolysis-driven protein transmembrane transporter activity
Process
protein transport
protein targeting
intracellular protein transport
protein secretion
Gene Properties
Locus tag: PA4276
Strand: -
Entrez Gene ID: 881694
Accession: NP_252966.1
GI: 15599472
Sequence start: 4783771
Sequence End: 4784139
Sequence Length: 368
Gene Sequence:
>PA4276
ATGAATGCCAAGGCAGAAGCCAAAGAATCACGTTTTGATCTCTTGAAATGGCTCTTGGTTGCCGTTCTGGTTGTGGTTGCCGTTGTGGGCAATCAGTACTTTTCGGCTCAACCAATCCTGTATCGCGTTCTCGGTATTCTCGTTCTGGCGGTGATCGCTGCTTTCCTGGCTCTGCAAACGGCCAAGGGGCAGGCCTTCTTTAGTCTTGCTAAGGAAGCGCGCGTCGAGATTCGCAAGGTCGTATGGCCGAGTCGTCAAGAAACAACTCAGACCACGCTGATCGTGGTCGCGGTAGTGCTGGTAATGGCGCTGCTGCTGTGGGGGCTCGATTCCCTGCTGGGTTGGTTGGTTTCCATGATTGTAGGTTAA
Protein Properties
Protein Residues: 122
Protein Molecular Weight: 13.4 kDa
Protein Theoretical pI: 10.38
Hydropathicity (GRAVY score): 0.99
Charge at pH 7 (predicted): 3.98
Protein Sequence:
>PA4276
MNAKAEAKESRFDLLKWLLVAVLVVVAVVGNQYFSAQPILYRVLGILVLAVIAAFLALQTAKGQAFFSLAKEARVEIRKVVWPSRQETTQTTLIVVAVVLVMALLLWGLDSLLGWLVSMIVG
References
External Links:
Resource Link
Genome ID: PA4276
Entrez Gene ID: 881694
NCBI Protein ID: 15599472
General Reference: PaperBLAST - Find papers about PA4276 and its homologs