50S ribosomal protein L23 (PA4261)
Identification | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|
Name: | 50S ribosomal protein L23 | |||||||||
Synonyms: | Not Available | |||||||||
Gene Name: | rplW | |||||||||
Enzyme Class: | Not Available | |||||||||
Biological Properties | ||||||||||
General Function: | cellular protein metabolic process, translation | |||||||||
Specific Function: | structural constituent of ribosome, nucleotide binding | |||||||||
Cellular Location: | Cytoplasmic | |||||||||
KEGG Pathways: |
| |||||||||
KEGG Reactions: | Not Available | |||||||||
SMPDB Reactions: | Not Available | |||||||||
PseudoCyc/BioCyc Reactions: |
| |||||||||
Complex Reactions: | Not Available | |||||||||
Transports: | Not Available | |||||||||
Metabolites: | Not Available | |||||||||
GO Classification: |
| |||||||||
Gene Properties | ||||||||||
Locus tag: | PA4261 | |||||||||
Strand: | - | |||||||||
Entrez Gene ID: | 881753 | |||||||||
Accession: | NP_252951.1 | |||||||||
GI: | 15599457 | |||||||||
Sequence start: | 4765713 | |||||||||
Sequence End: | 4766012 | |||||||||
Sequence Length: | 299 | |||||||||
Gene Sequence: |
>PA4261 ATGAACCAGGAACGCGTATTCAAAGTGCTGCTTGGTCCGCACATCTCCGAGAAAGCCACGGGTCTCGCGGACGGCAAGAGCCAATTCGTTTTCAAGGTTGCCACCGATGCAACCAAGCTGGAAATCAAGAAGGCCGTAGAAAGCCTGTTCAGCGTGAAGGTACAGCGCGTCACTACCCTGAACGTCAAGGGTAAGACCAAGCGCACCGCTCGCGGTCTGGGCAAGCGTAACGACTGGAAAAAAGCGTACATCGCTCTCCAGCCGGGCCAAGATCTCGATTTCGCCACCAGCGCTGAGTAA | |||||||||
Protein Properties | ||||||||||
Protein Residues: | 99 | |||||||||
Protein Molecular Weight: | 10.9 kDa | |||||||||
Protein Theoretical pI: | 10.81 | |||||||||
Hydropathicity (GRAVY score): | -0.421 | |||||||||
Charge at pH 7 (predicted): | 9.22 | |||||||||
Protein Sequence: |
>PA4261 MNQERVFKVLLGPHISEKATGLADGKSQFVFKVATDATKLEIKKAVESLFSVKVQRVTTLNVKGKTKRTARGLGKRNDWKKAYIALQPGQDLDFATSAE | |||||||||
References | ||||||||||
External Links: |
| |||||||||
General Reference: | PaperBLAST - Find papers about PA4261 and its homologs |