50S ribosomal protein L29 (PA4255)
Identification | |||||||||
---|---|---|---|---|---|---|---|---|---|
Name: | 50S ribosomal protein L29 | ||||||||
Synonyms: | Not Available | ||||||||
Gene Name: | rpmC | ||||||||
Enzyme Class: | Not Available | ||||||||
Biological Properties | |||||||||
General Function: | cellular protein metabolic process, translation | ||||||||
Specific Function: | structural constituent of ribosome | ||||||||
Cellular Location: | Cytoplasmic | ||||||||
KEGG Pathways: |
| ||||||||
KEGG Reactions: | Not Available | ||||||||
SMPDB Reactions: | Not Available | ||||||||
PseudoCyc/BioCyc Reactions: |
| ||||||||
Complex Reactions: | Not Available | ||||||||
Transports: | Not Available | ||||||||
Metabolites: | Not Available | ||||||||
GO Classification: |
| ||||||||
Gene Properties | |||||||||
Locus tag: | PA4255 | ||||||||
Strand: | - | ||||||||
Entrez Gene ID: | 881771 | ||||||||
Accession: | NP_252945.1 | ||||||||
GI: | 15599451 | ||||||||
Sequence start: | 4762928 | ||||||||
Sequence End: | 4763119 | ||||||||
Sequence Length: | 191 | ||||||||
Gene Sequence: |
>PA4255 ATGAAAGCGAATGAACTTCGTGAAAAATCCGTTGAGCAGCTGAACGAGCAACTGCTCGGCCTGCTGCGCGACCAGTTCAATCTGCGCATGCAGAAAGCAACTGGCCAGTTGGGGCAGTCTCACCTGCTCTCGCAGGTTAAGCGCGACATCGCTCGCGTTAAAACTGTGCTCAATCAGCAAGCAGGTAAGTGA | ||||||||
Protein Properties | |||||||||
Protein Residues: | 63 | ||||||||
Protein Molecular Weight: | 7.2 kDa | ||||||||
Protein Theoretical pI: | 11.05 | ||||||||
Hydropathicity (GRAVY score): | -0.7 | ||||||||
Charge at pH 7 (predicted): | 5.22 | ||||||||
Protein Sequence: |
>PA4255 MKANELREKSVEQLNEQLLGLLRDQFNLRMQKATGQLGQSHLLSQVKRDIARVKTVLNQQAGK | ||||||||
References | |||||||||
External Links: |
| ||||||||
General Reference: | PaperBLAST - Find papers about PA4255 and its homologs |