50S ribosomal protein L30 (PA4245)
Identification | |||||||||
---|---|---|---|---|---|---|---|---|---|
Name: | 50S ribosomal protein L30 | ||||||||
Synonyms: | Not Available | ||||||||
Gene Name: | rpmD | ||||||||
Enzyme Class: | Not Available | ||||||||
Biological Properties | |||||||||
General Function: | cellular protein metabolic process, translation | ||||||||
Specific Function: | structural constituent of ribosome | ||||||||
Cellular Location: | Cytoplasmic | ||||||||
KEGG Pathways: |
| ||||||||
KEGG Reactions: | Not Available | ||||||||
SMPDB Reactions: | Not Available | ||||||||
PseudoCyc/BioCyc Reactions: |
| ||||||||
Complex Reactions: | Not Available | ||||||||
Transports: | Not Available | ||||||||
Metabolites: | Not Available | ||||||||
GO Classification: |
| ||||||||
Gene Properties | |||||||||
Locus tag: | PA4245 | ||||||||
Strand: | - | ||||||||
Entrez Gene ID: | 881787 | ||||||||
Accession: | NP_252935.1 | ||||||||
GI: | 15599441 | ||||||||
Sequence start: | 4758891 | ||||||||
Sequence End: | 4759067 | ||||||||
Sequence Length: | 176 | ||||||||
Gene Sequence: |
>PA4245 ATGGCAACTGTCAAAGTCACTCTGGTCAAGAGCCTGAACGGCCGTCTGGCCAATCACAAGGCTTGCGTCAAGGGTCTCGGCCTGCGTCGCATCAATCATACCGTCGAAGTTCAGGACACTCCTGAGAACCGCGGCATGATCAACAAGGCCTACTACCTGCTGCGTGTGGAGGGTTAA | ||||||||
Protein Properties | |||||||||
Protein Residues: | 58 | ||||||||
Protein Molecular Weight: | 6.5 kDa | ||||||||
Protein Theoretical pI: | 10.73 | ||||||||
Hydropathicity (GRAVY score): | -0.253 | ||||||||
Charge at pH 7 (predicted): | 6.43 | ||||||||
Protein Sequence: |
>PA4245 MATVKVTLVKSLNGRLANHKACVKGLGLRRINHTVEVQDTPENRGMINKAYYLLRVEG | ||||||||
References | |||||||||
External Links: |
| ||||||||
General Reference: | PaperBLAST - Find papers about PA4245 and its homologs |