Identification
Name: NusB protein
Synonyms: ssyB
Gene Name: nusB
Enzyme Class: Not Available
Biological Properties
General Function: RNA metabolic process, regulation of DNA-templated transcription, termination, DNA-templated transcription, termination, regulation of transcription, DNA-templated
Specific Function: RNA binding
Cellular Location: Unknown
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites: Not Available
    GO Classification:
    Function
    RNA binding
    Process
    RNA metabolic process
    regulation of DNA-templated transcription, termination
    DNA-templated transcription, termination
    regulation of transcription, DNA-templated
    Gene Properties
    Locus tag: PA4052
    Strand: -
    Entrez Gene ID: 878643
    Accession: NP_252741.1
    GI: 15599247
    Sequence start: 4533640
    Sequence End: 4534119
    Sequence Length: 479
    Gene Sequence:
    >PA4052
    GTGAGCAATCAAGACAGCGGCAACCCGGCAGCCAAGCCGCCGAAAGGCAAGACCGCCGCTCGCCGCAAGGCCCGCAGCCTGGCCGTCCAGGCCCTGTACTCCTGGCAGATCGCCGGCCAGCCCCTGCACGAGATCGAGGCGCAGTTCCGCACCGACAACGACTTCTCCGAGGTCGACGGCGCCTACTTCCACGAGATCCTGCACGGCGTGCCGCGGCAGAAGAGCGAACTGGACTCCACCTTCGAGCCCTGCCTGGACCGCCCGCTGGCCGAGATCGACCCGGTCGAGCTGGCCATCCTGCGGCTGTCCACCTACGAGCTGCGCAACCGCATCGACGTGCCCTACAAGGTAGTGATCAACGAGGGCATCGAGCTGGCCAAGACCTTCGGCGCCACCGACGGCCACAAGTTCGTCAACGGCGTGCTCGACAAGCTGGCGCCGCGCCTGCGCGCCGCCGAGCTGCGCGGCGGCAAGCGCTGA
    Protein Properties
    Protein Residues: 159
    Protein Molecular Weight: 17.7 kDa
    Protein Theoretical pI: 8.47
    Hydropathicity (GRAVY score): -0.489
    Charge at pH 7 (predicted): 1.92
    Protein Sequence:
    >PA4052
    MSNQDSGNPAAKPPKGKTAARRKARSLAVQALYSWQIAGQPLHEIEAQFRTDNDFSEVDGAYFHEILHGVPRQKSELDSTFEPCLDRPLAEIDPVELAILRLSTYELRNRIDVPYKVVINEGIELAKTFGATDGHKFVNGVLDKLAPRLRAAELRGGKR
    References
    External Links:
    Resource Link
    Genome ID: PA4052
    Entrez Gene ID: 878643
    NCBI Protein ID: 15599247
    General Reference: PaperBLAST - Find papers about PA4052 and its homologs