Identification
Name: antirepressor for MexR, ArmR
Synonyms: Not Available
Gene Name: armR
Enzyme Class: Not Available
Biological Properties
General Function: positive regulation of transporter activity
Specific Function: Not Available
Cellular Location: Unknown
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites: Not Available
    GO Classification:
    Process
    positive regulation of transporter activity
    Gene Properties
    Locus tag: PA3719
    Strand: -
    Entrez Gene ID: 880376
    Accession: NP_252408.1
    GI: 15598914
    Sequence start: 4165719
    Sequence End: 4165880
    Sequence Length: 161
    Gene Sequence:
    >PA3719
    ATGTCCCTGAACACTCCGCGCAACAAACCGTCCCGCACCGAGACCGAAGCTGTCGCTGCCAGCTCGGGACGATCCGCCGTCGGCCGGCGGGATTACACCGAGCAGCTGCGCCGGGCAGCCCGGCGCAATGCCTGGGACCTCTACGGCGAGCACTTCTACTGA
    Protein Properties
    Protein Residues: 53
    Protein Molecular Weight: 6.1 kDa
    Protein Theoretical pI: 10.72
    Hydropathicity (GRAVY score): -1.16
    Charge at pH 7 (predicted): 4.22
    Protein Sequence:
    >PA3719
    MSLNTPRNKPSRTETEAVAASSGRSAVGRRDYTEQLRRAARRNAWDLYGEHFY
    References
    External Links:
    Resource Link
    Genome ID: PA3719
    Entrez Gene ID: 880376
    NCBI Protein ID: 15598914
    General Reference: PaperBLAST - Find papers about PA3719 and its homologs