Identification
Name: Histidine phosphotransfer protein HptB
Synonyms: Not Available
Gene Name: hptB
Enzyme Class: Not Available
Biological Properties
General Function: negative regulation of single-species biofilm formation, positive regulation of chemotaxis, regulation of cell motility, phosphorelay signal transduction system
Specific Function: histidine phosphotransfer kinase activity, signal transducer activity
Cellular Location: Cytoplasmic
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites: Not Available
    GO Classification:
    Function
    histidine phosphotransfer kinase activity
    signal transducer activity
    Process
    negative regulation of single-species biofilm formation
    positive regulation of chemotaxis
    regulation of cell motility
    phosphorelay signal transduction system
    Gene Properties
    Locus tag: PA3345
    Strand: -
    Entrez Gene ID: 882510
    Accession: NP_252035.1
    GI: 15598541
    Sequence start: 3757243
    Sequence End: 3757593
    Sequence Length: 350
    Gene Sequence:
    >PA3345
    ATGTCCGCGCCGCATCTCGATGATCGTGTTCTGGCTTCGCTGCAGGAGGTCATGGAGGACGAATATCCGGTCCTGCTGGATACCTTCGTGCTCGACTCCGAGGAGCGCCTGCGCAGCCTGCATGCCGCCCTCCAGGCCGGCGATGCCCAGGCTTTGCGGCATACCGCACACAGCTTCAAGGGAGGCAGCAGCAACATGGGCGCGGTACTCCTCGCCGGCTACTGCAAGGAGCTGGAGGAAAGCGCCAGGCGCGGCGAGCTGCAACGGGCGCCGGCGCTGATCGAACAGATGGAGCGCGAATTCGCCATCGTCCGCATCCTTTTCAAACAGGAACGTCAGCGCTATCGCTGA
    Protein Properties
    Protein Residues: 116
    Protein Molecular Weight: 13.2 kDa
    Protein Theoretical pI: 5.64
    Hydropathicity (GRAVY score): -0.396
    Charge at pH 7 (predicted): -3.08
    Protein Sequence:
    >PA3345
    MSAPHLDDRVLASLQEVMEDEYPVLLDTFVLDSEERLRSLHAALQAGDAQALRHTAHSFKGGSSNMGAVLLAGYCKELEESARRGELQRAPALIEQMEREFAIVRILFKQERQRYR
    References
    External Links:
    Resource Link
    Genome ID: PA3345
    Entrez Gene ID: 882510
    NCBI Protein ID: 15598541
    General Reference: PaperBLAST - Find papers about PA3345 and its homologs