cold acclimation protein B (PA3266)
| Identification | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Name: | cold acclimation protein B | ||||||||
| Synonyms: | cspA | ||||||||
| Gene Name: | capB | ||||||||
| Enzyme Class: | Not Available | ||||||||
| Biological Properties | |||||||||
| General Function: | regulation of transcription, DNA-templated, response to stimulus | ||||||||
| Specific Function: | DNA binding, nucleic acid binding | ||||||||
| Cellular Location: | Cytoplasmic | ||||||||
| KEGG Pathways: |
| ||||||||
| KEGG Reactions: | Not Available | ||||||||
| SMPDB Reactions: | Not Available | ||||||||
| PseudoCyc/BioCyc Reactions: |
| ||||||||
| Complex Reactions: | Not Available | ||||||||
| Transports: | Not Available | ||||||||
| Metabolites: | Not Available | ||||||||
| GO Classification: |
| ||||||||
| Gene Properties | |||||||||
| Locus tag: | PA3266 | ||||||||
| Strand: | + | ||||||||
| Entrez Gene ID: | 882429 | ||||||||
| Accession: | NP_251956.1 | ||||||||
| GI: | 15598462 | ||||||||
| Sequence start: | 3653667 | ||||||||
| Sequence End: | 3653876 | ||||||||
| Sequence Length: | 209 | ||||||||
| Gene Sequence: |
>PA3266 ATGTCGAATCGTCAGAACGGCACCGTAAAATGGTTCAACGACGCCAAAGGCTTCGGCTTCATCACCCCGGAAAGCGGTAACGACCTGTTCGTTCACTTCCGTTCCATCCAGGGCACCGGCTTCAAGAGCCTGCAGGAAGGCCAGAAGGTTTCCTTCGTGGTCGTCAACGGCCAGAAAGGCCTGCAAGCCGACGAAGTACAAGTTGTCTAA | ||||||||
| Protein Properties | |||||||||
| Protein Residues: | 69 | ||||||||
| Protein Molecular Weight: | 7.6 kDa | ||||||||
| Protein Theoretical pI: | 9.32 | ||||||||
| Hydropathicity (GRAVY score): | -0.342 | ||||||||
| Charge at pH 7 (predicted): | 1.22 | ||||||||
| Protein Sequence: |
>PA3266 MSNRQNGTVKWFNDAKGFGFITPESGNDLFVHFRSIQGTGFKSLQEGQKVSFVVVNGQKGLQADEVQVV | ||||||||
| References | |||||||||
| External Links: |
| ||||||||
| General Reference: | PaperBLAST - Find papers about PA3266 and its homologs | ||||||||