Identification
Name: cell division topological specificity factor MinE
Synonyms: Not Available
Gene Name: minE
Enzyme Class: Not Available
Biological Properties
General Function: FtsZ-dependent cytokinesis, regulation of barrier septum assembly, cell division
Specific Function: Not Available
Cellular Location: Cytoplasmic
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites: Not Available
    GO Classification:
    Process
    FtsZ-dependent cytokinesis
    regulation of barrier septum assembly
    cell division
    Gene Properties
    Locus tag: PA3245
    Strand: +
    Entrez Gene ID: 882408
    Accession: NP_251935.1
    GI: 15598441
    Sequence start: 3632430
    Sequence End: 3632684
    Sequence Length: 254
    Gene Sequence:
    >PA3245
    ATGAGCCTTTTAGACTTCTTTCGCAGTCGGAAATCGCAGAACAGCGCTTCCATCGCGAAAGAACGACTGCAGATCATCGTTGCCCACGAACGTGGCCAGCGCGCACAGCCGGATTATCTGCCCCAGTTGCAGAAAGACCTGCTGGAAGTGATCCGCAAGTACGTACCGATCGACCAGGAGCAGATCCAGGTGGAACTGGAGAACCAGGGCAACTGCTCGATCCTGGAACTCAACATCACCCTGCCGGATCGTTGA
    Protein Properties
    Protein Residues: 84
    Protein Molecular Weight: 9.8 kDa
    Protein Theoretical pI: 5.85
    Hydropathicity (GRAVY score): -0.533
    Charge at pH 7 (predicted): -0.8
    Protein Sequence:
    >PA3245
    MSLLDFFRSRKSQNSASIAKERLQIIVAHERGQRAQPDYLPQLQKDLLEVIRKYVPIDQEQIQVELENQGNCSILELNITLPDR
    References
    External Links:
    Resource Link
    Genome ID: PA3245
    Entrez Gene ID: 882408
    NCBI Protein ID: 15598441
    General Reference: PaperBLAST - Find papers about PA3245 and its homologs