cell division topological specificity factor MinE (PA3245)
Identification | |||||||||
---|---|---|---|---|---|---|---|---|---|
Name: | cell division topological specificity factor MinE | ||||||||
Synonyms: | Not Available | ||||||||
Gene Name: | minE | ||||||||
Enzyme Class: | Not Available | ||||||||
Biological Properties | |||||||||
General Function: | FtsZ-dependent cytokinesis, regulation of barrier septum assembly, cell division | ||||||||
Specific Function: | Not Available | ||||||||
Cellular Location: | Cytoplasmic | ||||||||
KEGG Pathways: |
| ||||||||
KEGG Reactions: | Not Available | ||||||||
SMPDB Reactions: | Not Available | ||||||||
PseudoCyc/BioCyc Reactions: |
| ||||||||
Complex Reactions: | Not Available | ||||||||
Transports: | Not Available | ||||||||
Metabolites: | Not Available | ||||||||
GO Classification: |
| ||||||||
Gene Properties | |||||||||
Locus tag: | PA3245 | ||||||||
Strand: | + | ||||||||
Entrez Gene ID: | 882408 | ||||||||
Accession: | NP_251935.1 | ||||||||
GI: | 15598441 | ||||||||
Sequence start: | 3632430 | ||||||||
Sequence End: | 3632684 | ||||||||
Sequence Length: | 254 | ||||||||
Gene Sequence: |
>PA3245 ATGAGCCTTTTAGACTTCTTTCGCAGTCGGAAATCGCAGAACAGCGCTTCCATCGCGAAAGAACGACTGCAGATCATCGTTGCCCACGAACGTGGCCAGCGCGCACAGCCGGATTATCTGCCCCAGTTGCAGAAAGACCTGCTGGAAGTGATCCGCAAGTACGTACCGATCGACCAGGAGCAGATCCAGGTGGAACTGGAGAACCAGGGCAACTGCTCGATCCTGGAACTCAACATCACCCTGCCGGATCGTTGA | ||||||||
Protein Properties | |||||||||
Protein Residues: | 84 | ||||||||
Protein Molecular Weight: | 9.8 kDa | ||||||||
Protein Theoretical pI: | 5.85 | ||||||||
Hydropathicity (GRAVY score): | -0.533 | ||||||||
Charge at pH 7 (predicted): | -0.8 | ||||||||
Protein Sequence: |
>PA3245 MSLLDFFRSRKSQNSASIAKERLQIIVAHERGQRAQPDYLPQLQKDLLEVIRKYVPIDQEQIQVELENQGNCSILELNITLPDR | ||||||||
References | |||||||||
External Links: |
| ||||||||
General Reference: | PaperBLAST - Find papers about PA3245 and its homologs |