transposase with Helix-turn-helix Hin domain hypothetical protein (PA3144)
| Identification | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Name: | transposase with Helix-turn-helix Hin domain hypothetical protein | ||||||||
| Synonyms: | Not Available | ||||||||
| Gene Name: | Not Available | ||||||||
| Enzyme Class: | Not Available | ||||||||
| Biological Properties | |||||||||
| General Function: | transposition, DNA-mediated | ||||||||
| Specific Function: | DNA binding, transposase activity, transferase activity, transferring glycosyl groups | ||||||||
| Cellular Location: | Cytoplasmic | ||||||||
| KEGG Pathways: |
| ||||||||
| KEGG Reactions: | Not Available | ||||||||
| SMPDB Reactions: | Not Available | ||||||||
| PseudoCyc/BioCyc Reactions: |
| ||||||||
| Complex Reactions: | Not Available | ||||||||
| Transports: | Not Available | ||||||||
| Metabolites: | Not Available | ||||||||
| GO Classification: |
| ||||||||
| Gene Properties | |||||||||
| Locus tag: | PA3144 | ||||||||
| Strand: | - | ||||||||
| Entrez Gene ID: | Not Available | ||||||||
| Accession: | NP_251834 | ||||||||
| GI: | 15598340 | ||||||||
| Sequence start: | 3528231 | ||||||||
| Sequence End: | 3528350 | ||||||||
| Sequence Length: | 119 | ||||||||
| Gene Sequence: |
>PA3144 GTGAAAAAGCGTTTTACTGAAGAACAGATTCTAGACTTTCTGAAGCAGGCAGAAGCCGGTGTGCCGGTGAAGGAGCTGTGTCGCCGACACAGCTTCAGTGATGCCACGTTCTACACCTAG | ||||||||
| Protein Properties | |||||||||
| Protein Residues: | 39 | ||||||||
| Protein Molecular Weight: | 4.6 kDa | ||||||||
| Protein Theoretical pI: | 8.52 | ||||||||
| Hydropathicity (GRAVY score): | -0.505 | ||||||||
| Charge at pH 7 (predicted): | 1.19 | ||||||||
| Protein Sequence: |
>PA3144 MKKRFTEEQILDFLKQAEAGVPVKELCRRHSFSDATFYT | ||||||||
| References | |||||||||
| External Links: |
| ||||||||
| General Reference: | PaperBLAST - Find papers about PA3144 and its homologs | ||||||||