ribosome modulation factor (PA3049)
| Identification | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Name: | ribosome modulation factor | ||||||||
| Synonyms: | Not Available | ||||||||
| Gene Name: | rmf | ||||||||
| Enzyme Class: | Not Available | ||||||||
| Biological Properties | |||||||||
| General Function: | cellular protein metabolic process, negative regulation of translation | ||||||||
| Specific Function: | Not Available | ||||||||
| Cellular Location: | Unknown | ||||||||
| KEGG Pathways: |
| ||||||||
| KEGG Reactions: | Not Available | ||||||||
| SMPDB Reactions: | Not Available | ||||||||
| PseudoCyc/BioCyc Reactions: |
| ||||||||
| Complex Reactions: | Not Available | ||||||||
| Transports: | Not Available | ||||||||
| Metabolites: | Not Available | ||||||||
| GO Classification: |
| ||||||||
| Gene Properties | |||||||||
| Locus tag: | PA3049 | ||||||||
| Strand: | + | ||||||||
| Entrez Gene ID: | 882866 | ||||||||
| Accession: | NP_251739.1 | ||||||||
| GI: | 15598245 | ||||||||
| Sequence start: | 3414401 | ||||||||
| Sequence End: | 3414613 | ||||||||
| Sequence Length: | 212 | ||||||||
| Gene Sequence: |
>PA3049 ATGAGAAGACTTAAGCGTGATCCGTTGGAAAGAGCCTTCTTGCGTGGTTATCAGAACGGCATAACCGGTAAATCTCGTGATCTTTGTCCGTTCACCCATCCTACGACGCGGCAGTCCTGGCTCAACGGCTGGCGCGAGGGCCGTGGCGACAACTGGGACGGCCTCACTGGCACGGCCGGCTTACAACGTCTCAATCAACTCCAGCACGTGTAA | ||||||||
| Protein Properties | |||||||||
| Protein Residues: | 70 | ||||||||
| Protein Molecular Weight: | 8.1 kDa | ||||||||
| Protein Theoretical pI: | 11.66 | ||||||||
| Hydropathicity (GRAVY score): | -1.049 | ||||||||
| Charge at pH 7 (predicted): | 6.43 | ||||||||
| Protein Sequence: |
>PA3049 MRRLKRDPLERAFLRGYQNGITGKSRDLCPFTHPTTRQSWLNGWREGRGDNWDGLTGTAGLQRLNQLQHV | ||||||||
| References | |||||||||
| External Links: |
| ||||||||
| General Reference: | PaperBLAST - Find papers about PA3049 and its homologs | ||||||||