ribosome modulation factor (PA3049)
Identification | |||||||||
---|---|---|---|---|---|---|---|---|---|
Name: | ribosome modulation factor | ||||||||
Synonyms: | Not Available | ||||||||
Gene Name: | rmf | ||||||||
Enzyme Class: | Not Available | ||||||||
Biological Properties | |||||||||
General Function: | cellular protein metabolic process, negative regulation of translation | ||||||||
Specific Function: | Not Available | ||||||||
Cellular Location: | Unknown | ||||||||
KEGG Pathways: |
| ||||||||
KEGG Reactions: | Not Available | ||||||||
SMPDB Reactions: | Not Available | ||||||||
PseudoCyc/BioCyc Reactions: |
| ||||||||
Complex Reactions: | Not Available | ||||||||
Transports: | Not Available | ||||||||
Metabolites: | Not Available | ||||||||
GO Classification: |
| ||||||||
Gene Properties | |||||||||
Locus tag: | PA3049 | ||||||||
Strand: | + | ||||||||
Entrez Gene ID: | 882866 | ||||||||
Accession: | NP_251739.1 | ||||||||
GI: | 15598245 | ||||||||
Sequence start: | 3414401 | ||||||||
Sequence End: | 3414613 | ||||||||
Sequence Length: | 212 | ||||||||
Gene Sequence: |
>PA3049 ATGAGAAGACTTAAGCGTGATCCGTTGGAAAGAGCCTTCTTGCGTGGTTATCAGAACGGCATAACCGGTAAATCTCGTGATCTTTGTCCGTTCACCCATCCTACGACGCGGCAGTCCTGGCTCAACGGCTGGCGCGAGGGCCGTGGCGACAACTGGGACGGCCTCACTGGCACGGCCGGCTTACAACGTCTCAATCAACTCCAGCACGTGTAA | ||||||||
Protein Properties | |||||||||
Protein Residues: | 70 | ||||||||
Protein Molecular Weight: | 8.1 kDa | ||||||||
Protein Theoretical pI: | 11.66 | ||||||||
Hydropathicity (GRAVY score): | -1.049 | ||||||||
Charge at pH 7 (predicted): | 6.43 | ||||||||
Protein Sequence: |
>PA3049 MRRLKRDPLERAFLRGYQNGITGKSRDLCPFTHPTTRQSWLNGWREGRGDNWDGLTGTAGLQRLNQLQHV | ||||||||
References | |||||||||
External Links: |
| ||||||||
General Reference: | PaperBLAST - Find papers about PA3049 and its homologs |