Identification
Name: 50S ribosomal protein L32
Synonyms: Not Available
Gene Name: rpmF
Enzyme Class: Not Available
Biological Properties
General Function: cellular protein metabolic process, translation
Specific Function: structural constituent of ribosome
Cellular Location: Cytoplasmic
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites: Not Available
    GO Classification:
    Function
    structural constituent of ribosome
    Process
    cellular protein metabolic process
    translation
    Gene Properties
    Locus tag: PA2970
    Strand: -
    Entrez Gene ID: 880144
    Accession: NP_251660.1
    GI: 15598166
    Sequence start: 3328203
    Sequence End: 3328385
    Sequence Length: 182
    Gene Sequence:
    >PA2970
    ATGGCTGTTCAGCAGAACAAAAAGTCTCGTTCCGCTCGTGACATGCGTCGTTCCCACGATGCGCTCGAGTCCAATGCTCTGTCCGTGGAAAAGAGCACCGGTGAAGTCCACCTGCGCCACCACGTATCCCCGGACGGCTTCTATCGCGGCCGTAAGGTAGTAGACAAGGGCTCCGACGAGTAA
    Protein Properties
    Protein Residues: 60
    Protein Molecular Weight: 6.8 kDa
    Protein Theoretical pI: 10.36
    Hydropathicity (GRAVY score): -1.175
    Charge at pH 7 (predicted): 3.94
    Protein Sequence:
    >PA2970
    MAVQQNKKSRSARDMRRSHDALESNALSVEKSTGEVHLRHHVSPDGFYRGRKVVDKGSDE
    References
    External Links:
    Resource Link
    Genome ID: PA2970
    Entrez Gene ID: 880144
    NCBI Protein ID: 15598166
    General Reference: PaperBLAST - Find papers about PA2970 and its homologs