Identification
Name: MvaU
Synonyms: Not Available
Gene Name: mvaU
Enzyme Class: Not Available
Biological Properties
General Function: regulation of L-arginine import, negative regulation of secondary metabolite biosynthetic process, regulation of transcription, DNA-templated
Specific Function: transcription regulatory region DNA binding, DNA binding
Cellular Location: Cytoplasmic
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites: Not Available
    GO Classification:
    Component
    intracellular
    Function
    transcription regulatory region DNA binding
    DNA binding
    Process
    regulation of L-arginine import
    negative regulation of secondary metabolite biosynthetic process
    regulation of transcription, DNA-templated
    Gene Properties
    Locus tag: PA2667
    Strand: +
    Entrez Gene ID: 882376
    Accession: NP_251357.1
    GI: 15597863
    Sequence start: 3016246
    Sequence End: 3016599
    Sequence Length: 353
    Gene Sequence:
    >PA2667
    ATGTCCAAACTTGCCGAGTTCCGCGAGGCAGAGCGCAAACTTCAGGAGCAACTGGCCCTGCTGGAAAAGCTGAAAAGCGACAGCAGCCTGAAGCAGGAACTGGAATTCAAGGACAAGTTGCAGGCGTTGATGGACAAGTACGGCATGACCCTGCACAACATCATCGCCATCCTCGACCCCAAGGCTCCGGTCACCGTCAGCGCCGCTCCGCAGCGCCGTGCCCGCGCCCTGAAGGTCTACAAGAACCCGAACAACGGTGAAGTCGTCGAAACCAAGGGCGGCAACCACAAGGTTCTGAAAGCCTGGAAAGAACAGTACGGTTCCGAAACCGTCGAATCCTGGCTGCAACGCTAA
    Protein Properties
    Protein Residues: 117
    Protein Molecular Weight: 13.4 kDa
    Protein Theoretical pI: 10.1
    Hydropathicity (GRAVY score): -0.696
    Charge at pH 7 (predicted): 5.47
    Protein Sequence:
    >PA2667
    MSKLAEFREAERKLQEQLALLEKLKSDSSLKQELEFKDKLQALMDKYGMTLHNIIAILDPKAPVTVSAAPQRRARALKVYKNPNNGEVVETKGGNHKVLKAWKEQYGSETVESWLQR
    References
    External Links:
    Resource Link
    Genome ID: PA2667
    Entrez Gene ID: 882376
    NCBI Protein ID: 15597863
    General Reference: PaperBLAST - Find papers about PA2667 and its homologs