Identification
Name: psl and pyoverdine operon regulator, PpyR
Synonyms: Not Available
Gene Name: ppyR
Enzyme Class: Not Available
Biological Properties
General Function: Not Available
Specific Function: Not Available
Cellular Location: Cytoplasmic Membrane
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites: Not Available
    GO Classification: Not Available
    Gene Properties
    Locus tag: PA2663
    Strand: -
    Entrez Gene ID: 882372
    Accession: NP_251353.1
    GI: 15597859
    Sequence start: 3012280
    Sequence End: 3012537
    Sequence Length: 257
    Gene Sequence:
    >PA2663
    ATGAACGCTCTGTTCGATTGTCCACGGCGGGTGCTGCGGATCGGTCACGGGCTGCTGGCGGCCGGCCTGGCGCTGCTCGTCGCCGGCGTGATCGCCGCCTATTTCCTCGACCGCTACCTGAACATGCCGGCGCTGGTGTTTTCCCATGCGCTGGTGATCCTCGGCCCGACCCTGTTGAAGATCGGCTACGTGATGCGCCTGAGCGCGCTGTTCCGCATGCGTCGACCCGGTTGGGAGGTCTGCTGTGCAAGTGCTTGA
    Protein Properties
    Protein Residues: 85
    Protein Molecular Weight: 9.3 kDa
    Protein Theoretical pI: 10.27
    Hydropathicity (GRAVY score): 0.885
    Charge at pH 7 (predicted): 6.36
    Protein Sequence:
    >PA2663
    MNALFDCPRRVLRIGHGLLAAGLALLVAGVIAAYFLDRYLNMPALVFSHALVILGPTLLKIGYVMRLSALFRMRRPGWEVCCASA
    References
    External Links:
    Resource Link
    Genome ID: PA2663
    Entrez Gene ID: 882372
    NCBI Protein ID: 15597859
    General Reference: PaperBLAST - Find papers about PA2663 and its homologs