ClpS (PA2621)
| Identification | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Name: | ClpS | ||||||||
| Synonyms: | Not Available | ||||||||
| Gene Name: | clpS | ||||||||
| Enzyme Class: | Not Available | ||||||||
| Biological Properties | |||||||||
| General Function: | bacterial-type flagellum-dependent swarming motility, cellular response to antibiotic, single-species biofilm formation, single-species biofilm formation on inanimate substrate, protein catabolic process | ||||||||
| Specific Function: | Not Available | ||||||||
| Cellular Location: | Cytoplasmic | ||||||||
| KEGG Pathways: |
| ||||||||
| KEGG Reactions: | Not Available | ||||||||
| SMPDB Reactions: | Not Available | ||||||||
| PseudoCyc/BioCyc Reactions: |
| ||||||||
| Complex Reactions: | Not Available | ||||||||
| Transports: | Not Available | ||||||||
| Metabolites: | Not Available | ||||||||
| GO Classification: |
| ||||||||
| Gene Properties | |||||||||
| Locus tag: | PA2621 | ||||||||
| Strand: | - | ||||||||
| Entrez Gene ID: | 882327 | ||||||||
| Accession: | NP_251311 | ||||||||
| GI: | 161486763 | ||||||||
| Sequence start: | 2964607 | ||||||||
| Sequence End: | 2964843 | ||||||||
| Sequence Length: | 236 | ||||||||
| Gene Sequence: |
>PA2621 GTGGTACTGTTCAACGACGATTACACGCCGATGGACTTTGTTGTTGAAGTGCTGGAAGTGTTCTTCAACATGGACCGGGAAAAAGCCACCAAGATCATGTTGACGGTACATACTCAGGGTAAGGCGGTCTGCGGCTTGTTTACCCGGGACGTGGCCGAAACCAAGGCGATGCAGGTCAATCAGTATGCACGGGAGAGCCAGCATCCATTGCTCTGCGAGATAGAGAAAGACAGTTGA | ||||||||
| Protein Properties | |||||||||
| Protein Residues: | 78 | ||||||||
| Protein Molecular Weight: | 9 kDa | ||||||||
| Protein Theoretical pI: | 4.55 | ||||||||
| Hydropathicity (GRAVY score): | -0.159 | ||||||||
| Charge at pH 7 (predicted): | -4.59 | ||||||||
| Protein Sequence: |
>PA2621 MVLFNDDYTPMDFVVEVLEVFFNMDREKATKIMLTVHTQGKAVCGLFTRDVAETKAMQVNQYARESQHPLLCEIEKDS | ||||||||
| References | |||||||||
| External Links: |
| ||||||||
| General Reference: | PaperBLAST - Find papers about PA2621 and its homologs | ||||||||