SrfA (PA2559.1)
| Identification | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Name: | SrfA | ||||||||
| Synonyms: | Not Available | ||||||||
| Gene Name: | srfA | ||||||||
| Enzyme Class: | Not Available | ||||||||
| Biological Properties | |||||||||
| General Function: | cellular response to cell envelope stress | ||||||||
| Specific Function: | Not Available | ||||||||
| Cellular Location: | Not Available | ||||||||
| KEGG Pathways: |
| ||||||||
| KEGG Reactions: | Not Available | ||||||||
| SMPDB Reactions: | Not Available | ||||||||
| PseudoCyc/BioCyc Reactions: |
| ||||||||
| Complex Reactions: | Not Available | ||||||||
| Transports: | Not Available | ||||||||
| Metabolites: | Not Available | ||||||||
| GO Classification: |
| ||||||||
| Gene Properties | |||||||||
| Locus tag: | PA2559.1 | ||||||||
| Strand: | + | ||||||||
| Entrez Gene ID: | 17373363 | ||||||||
| Accession: | YP_008719755.1 | ||||||||
| GI: | Not Available | ||||||||
| Sequence start: | 2894147 | ||||||||
| Sequence End: | 2894377 | ||||||||
| Sequence Length: | 230 | ||||||||
| Gene Sequence: |
>PA2559.1 ATGGCTGAACCCCAGGACAAGTACACCCGGCGCACAGGCAGGACCTGGGCGGACGACCAGGCGACCTACAACCGTCTGCGCGAAGAAGCCGACGCCGCTCGCCAGAAGCTGCGCGAAAGCGGCTACAGCGGCGCCGAGTACGACCAGTTGCGTCAAGCCGCCTTCGATCTCAACCGCAAGGCCAACCAGTACTGGGAGCAGATGCTCAGCGACCTGCGCCAGGAAGACTGA | ||||||||
| Protein Properties | |||||||||
| Protein Residues: | 76 | ||||||||
| Protein Molecular Weight: | Not Available kDa | ||||||||
| Protein Theoretical pI: | Not Available | ||||||||
| Hydropathicity (GRAVY score): | Not Available | ||||||||
| Charge at pH 7 (predicted): | Not Available | ||||||||
| Protein Sequence: |
>PA2559.1 MAEPQDKYTRRTGRTWADDQATYNRLREEADAARQKLRESGYSGAEYDQLRQAAFDLNRKANQYWEQMLSDLRQED | ||||||||
| References | |||||||||
| External Links: |
| ||||||||
| General Reference: | PaperBLAST - Find papers about PA2559.1 and its homologs | ||||||||