| Identification |
| Name: |
sigma factor PvdS |
| Synonyms: |
Not Available |
| Gene Name: |
pvdS |
| Enzyme Class: |
Not Available |
| Biological Properties |
| General Function: |
positive regulation of secondary metabolite biosynthetic process, regulation of transcription, DNA-templated, DNA-templated transcription, initiation, positive regulation of secondary metabolite biosynthetic process, positive regulation of secondary metabolite biosynthetic process, positive regulation of secondary metabolite biosynthetic process, positive regulation of secondary metabolite biosynthetic process, positive regulation of secondary metabolite biosynthetic process |
| Specific Function: |
sigma factor activity, sequence-specific DNA binding transcription factor activity, DNA binding, sigma factor activity, sigma factor activity, protein binding |
| Cellular Location: |
Cytoplasmic |
| KEGG Pathways: |
|
| KEGG Reactions: |
Not Available |
| SMPDB Reactions: |
Not Available |
| PseudoCyc/BioCyc Reactions: |
|
| Complex Reactions: |
Not Available |
| Transports: |
Not Available |
| Metabolites: |
Not Available |
| GO Classification: |
| Function |
|---|
| sigma factor activity | | sequence-specific DNA binding transcription factor activity | | DNA binding | | sigma factor activity | | sigma factor activity | | protein binding | | Process |
|---|
| positive regulation of secondary metabolite biosynthetic process | | regulation of transcription, DNA-templated | | DNA-templated transcription, initiation | | positive regulation of secondary metabolite biosynthetic process | | positive regulation of secondary metabolite biosynthetic process | | positive regulation of secondary metabolite biosynthetic process | | positive regulation of secondary metabolite biosynthetic process | | positive regulation of secondary metabolite biosynthetic process |
|
| Gene Properties |
| Locus tag: |
PA2426 |
| Strand: |
+ |
| Entrez Gene ID: |
882839 |
| Accession: |
NP_251116.1 |
| GI: |
15597622 |
| Sequence start: |
2722175 |
| Sequence End: |
2722738 |
| Sequence Length: |
563 |
| Gene Sequence: |
>PA2426
ATGTCGGAACAACTGTCTACCCGCAGATGCGATACCCCGCTCCTCCAGGCATTCGTCGATAACCGTACGATCCTGGTGAAGATCGCCGCCCGCATTACCGGTTGCCGCTCGCGAGCCGAAGATGTGGTCCAGGATGCGTTCTTCAGGCTCCAGTCGGCGCCGCAGATCACTTCGTCGTTCAAGGCACAGCTCAGCTACCTGTTCCAGATCGTCCGCAACCTGGCCATCGATCACTACCGCAAGCAGGCGCTCGAACAGAAATACTCGGGGCCGGAGGAAGAAGGCCTGAACGTGGTGATCCAGGGCGCCTCGCCGGAAACCTCGCACATCAACTACGCGACCCTCGAACACATCGCGGATGCCCTCACCGAGCTGCCCAAGCGCACCCGCTACGCCTTCGAGATGTACCGCCTGCACGGCGTGCCACAGAAGGACATCGCCAAGGAACTGGGCGTCTCGCCGACCCTGGTCAACTTCATGATCCGCGACGCCCTGGTGCACTGCCGCAAGGTCACCGCCGAGCGCCAGGGCGACAACGTCACCCATCTCAGCGCCCGCCGCTGA |
| Protein Properties |
| Protein Residues: |
187 |
| Protein Molecular Weight: |
21.2 kDa |
| Protein Theoretical pI: |
9.15 |
| Hydropathicity (GRAVY score): |
-0.35 |
| Charge at pH 7 (predicted): |
5.34 |
| Protein Sequence: |
>PA2426
MSEQLSTRRCDTPLLQAFVDNRTILVKIAARITGCRSRAEDVVQDAFFRLQSAPQITSSFKAQLSYLFQIVRNLAIDHYRKQALEQKYSGPEEEGLNVVIQGASPETSHINYATLEHIADALTELPKRTRYAFEMYRLHGVPQKDIAKELGVSPTLVNFMIRDALVHCRKVTAERQGDNVTHLSARR |
| References |
| External Links: |
|
| General Reference: |
PaperBLAST - Find papers about PA2426 and its homologs
|