sigma factor PvdS (PA2426)

Identification
Name: sigma factor PvdS
Synonyms: Not Available
Gene Name: pvdS
Enzyme Class: Not Available
Biological Properties
General Function: positive regulation of secondary metabolite biosynthetic process, regulation of transcription, DNA-templated, DNA-templated transcription, initiation, positive regulation of secondary metabolite biosynthetic process, positive regulation of secondary metabolite biosynthetic process, positive regulation of secondary metabolite biosynthetic process, positive regulation of secondary metabolite biosynthetic process, positive regulation of secondary metabolite biosynthetic process
Specific Function: sigma factor activity, sequence-specific DNA binding transcription factor activity, DNA binding, sigma factor activity, sigma factor activity, protein binding
Cellular Location: Cytoplasmic
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites: Not Available
    GO Classification:
    Function
    sigma factor activity
    sequence-specific DNA binding transcription factor activity
    DNA binding
    sigma factor activity
    sigma factor activity
    protein binding
    Process
    positive regulation of secondary metabolite biosynthetic process
    regulation of transcription, DNA-templated
    DNA-templated transcription, initiation
    positive regulation of secondary metabolite biosynthetic process
    positive regulation of secondary metabolite biosynthetic process
    positive regulation of secondary metabolite biosynthetic process
    positive regulation of secondary metabolite biosynthetic process
    positive regulation of secondary metabolite biosynthetic process
    Gene Properties
    Locus tag: PA2426
    Strand: +
    Entrez Gene ID: 882839
    Accession: NP_251116.1
    GI: 15597622
    Sequence start: 2722175
    Sequence End: 2722738
    Sequence Length: 563
    Gene Sequence: 
    >PA2426
ATGTCGGAACAACTGTCTACCCGCAGATGCGATACCCCGCTCCTCCAGGCATTCGTCGATAACCGTACGATCCTGGTGAAGATCGCCGCCCGCATTACCGGTTGCCGCTCGCGAGCCGAAGATGTGGTCCAGGATGCGTTCTTCAGGCTCCAGTCGGCGCCGCAGATCACTTCGTCGTTCAAGGCACAGCTCAGCTACCTGTTCCAGATCGTCCGCAACCTGGCCATCGATCACTACCGCAAGCAGGCGCTCGAACAGAAATACTCGGGGCCGGAGGAAGAAGGCCTGAACGTGGTGATCCAGGGCGCCTCGCCGGAAACCTCGCACATCAACTACGCGACCCTCGAACACATCGCGGATGCCCTCACCGAGCTGCCCAAGCGCACCCGCTACGCCTTCGAGATGTACCGCCTGCACGGCGTGCCACAGAAGGACATCGCCAAGGAACTGGGCGTCTCGCCGACCCTGGTCAACTTCATGATCCGCGACGCCCTGGTGCACTGCCGCAAGGTCACCGCCGAGCGCCAGGGCGACAACGTCACCCATCTCAGCGCCCGCCGCTGA
    Protein Properties
    Protein Residues: 187
    Protein Molecular Weight: 21.2 kDa
    Protein Theoretical pI: 9.15
    Hydropathicity (GRAVY score): -0.35
    Charge at pH 7 (predicted): 5.34
    Protein Sequence: 
    >PA2426
MSEQLSTRRCDTPLLQAFVDNRTILVKIAARITGCRSRAEDVVQDAFFRLQSAPQITSSFKAQLSYLFQIVRNLAIDHYRKQALEQKYSGPEEEGLNVVIQGASPETSHINYATLEHIADALTELPKRTRYAFEMYRLHGVPQKDIAKELGVSPTLVNFMIRDALVHCRKVTAERQGDNVTHLSARR
    References
    External Links:
    Resource Link
    Genome ID: PA2426
    Entrez Gene ID: 882839
    NCBI Protein ID: 15597622
    General Reference: PaperBLAST - Find papers about PA2426 and its homologs