Identification
Name: SoxR
Synonyms: soxR
Gene Name: soxR
Enzyme Class: Not Available
Biological Properties
General Function: response to oxidative stress, regulation of transcription, DNA-templated
Specific Function: 2 iron, 2 sulfur cluster binding, DNA binding
Cellular Location: Cytoplasmic
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites: Not Available
    GO Classification:
    Function
    2 iron, 2 sulfur cluster binding
    DNA binding
    Process
    response to oxidative stress
    regulation of transcription, DNA-templated
    Gene Properties
    Locus tag: PA2273
    Strand: -
    Entrez Gene ID: 882298
    Accession: NP_250963.1
    GI: 15597469
    Sequence start: 2503425
    Sequence End: 2503895
    Sequence Length: 470
    Gene Sequence:
    >PA2273
    ATGAAGAATTCCTGCGCATCTCGTGAACTGAGCGTCGGCGAACTGGCCAGGCGTGCCGGCGTGGCGGTCTCCGCCCTGCATTTCTACGAAACCAAGGGGCTGATCAGCAGCCAGCGCAACGCCGGCAACCAGCGGCGCTTCAGTCGCGAGACGCTACGCCGGGTGGTGGTGATCAAGGTCGCCCAGCGGGTCGGCATTCCCCTCGCGGAGATCGCTCGCGCCCTGCAGACCCTGCCGGCGGGGCGCAGCCCTAGCGCGGCGGACTGGGCGCGCCTGTCGGCGCAGTGGAAGGAGGATCTCACCGAGCGCATCGACAAGCTGCTGCTGTTGCGCGACCAACTGGACGGCTGCATCGGTTGCGGCTGCCTGTCGCTCCAGGCCTGCCCGTTGCGCAACCCCGGCGACCAGCTTTCCGCCGAGGGGCCGGGAGCGCACTGGCTGGACGCCGAGGGCCGCGAGCACGACGGCTAG
    Protein Properties
    Protein Residues: 156
    Protein Molecular Weight: 17 kDa
    Protein Theoretical pI: 8.79
    Hydropathicity (GRAVY score): -0.329
    Charge at pH 7 (predicted): 4.56
    Protein Sequence:
    >PA2273
    MKNSCASRELSVGELARRAGVAVSALHFYETKGLISSQRNAGNQRRFSRETLRRVVVIKVAQRVGIPLAEIARALQTLPAGRSPSAADWARLSAQWKEDLTERIDKLLLLRDQLDGCIGCGCLSLQACPLRNPGDQLSAEGPGAHWLDAEGREHDG
    References
    External Links:
    Resource Link
    Genome ID: PA2273
    Entrez Gene ID: 882298
    NCBI Protein ID: 15597469
    General Reference: PaperBLAST - Find papers about PA2273 and its homologs