fimbrial subunit CupA1 probable fimbrial protein (precursor); component of adhesin (PA2128)

Identification
Name: fimbrial subunit CupA1 probable fimbrial protein (precursor); component of adhesin
Synonyms: Not Available
Gene Name: cupA1
Enzyme Class: Not Available
Biological Properties
General Function: movement of cell or subcellular component, cell adhesion, cellular response to sodium dodecyl sulfate, cell aggregation, cellular response to oxygen levels, cellular response to organic cyclic compound, cellular response to organic cyclic compound, pathogenesis, cellular response to oxygen levels
Specific Function: Not Available
Cellular Location: Extracellular
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites: Not Available
    GO Classification:
    Component
    pilus
    Process
    movement of cell or subcellular component
    cell adhesion
    cellular response to sodium dodecyl sulfate
    cell aggregation
    cellular response to oxygen levels
    cellular response to organic cyclic compound
    cellular response to organic cyclic compound
    pathogenesis
    cellular response to oxygen levels
    Gene Properties
    Locus tag: PA2128
    Strand: +
    Entrez Gene ID: 880862
    Accession: NP_250818.1
    GI: 15597324
    Sequence start: 2342493
    Sequence End: 2343044
    Sequence Length: 551
    Gene Sequence: 
    >PA2128
ATGACCAGAACTTCGAACCCATGCGCAGTGGTATTGGCCTTTGCGGCAATTGCCGCTTCGGGAACCGCGATGGCGGCAAACACTATCACATTCAGCGGCGAAGTGACCGACCAGACCTGCCAGGTCGCGGTCAACGGCTTCACCGACCCCACGGTGATCCTCGACAGCGTACCGGTGAGCGCCCTCGATGGCGCAGTGGGCCGCAGCGCCGGCGAAACCGCCTTCACCCTGCAACTCACCGATTGCGTCGCGCCGACGGCCGACGAGCATTTCACCACCCTGTTCCAGGCCACCAACCCCAGCGCCGCCGGGAACCTGGTGAACACCGCCGCCAGCGGCGCGACGGGCGTGGCGCTGCAATTGCTCGATAGCGTCGGCGGCAACCCGGTCGACCTGGCCGGCGGCGCGGCGGTGCCCGCCGGCGACATCGTGCTCGCCAACGGAGCCACCAGCACCAGCTACGACTACGCGGTGCAGTACGTCTCCGAAGCGGCGACCGTGACGCCCGGTCCGGTACTCGGCGTCGTGACCTACACGCTGCGTTACGAGTGA
    Protein Properties
    Protein Residues: 183
    Protein Molecular Weight: 18.2 kDa
    Protein Theoretical pI: 3.59
    Hydropathicity (GRAVY score): 0.421
    Charge at pH 7 (predicted): -11.87
    Protein Sequence: 
    >PA2128
MTRTSNPCAVVLAFAAIAASGTAMAANTITFSGEVTDQTCQVAVNGFTDPTVILDSVPVSALDGAVGRSAGETAFTLQLTDCVAPTADEHFTTLFQATNPSAAGNLVNTAASGATGVALQLLDSVGGNPVDLAGGAAVPAGDIVLANGATSTSYDYAVQYVSEAATVTPGPVLGVVTYTLRYE
    References
    External Links:
    Resource Link
    Genome ID: PA2128
    Entrez Gene ID: 880862
    NCBI Protein ID: 15597324
    General Reference: PaperBLAST - Find papers about PA2128 and its homologs