Identification
Name: probable sigma-70 factor, ECF subfamily
Synonyms: Not Available
Gene Name: Not Available
Enzyme Class: Not Available
Biological Properties
General Function: regulation of transcription, DNA-templated, DNA-templated transcription, initiation, regulation of metal ion transport
Specific Function: DNA binding, sigma factor activity, sequence-specific DNA binding transcription factor activity
Cellular Location: Cytoplasmic
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites: Not Available
    GO Classification:
    Component
    cytosol
    Function
    DNA binding
    sigma factor activity
    sequence-specific DNA binding transcription factor activity
    Process
    regulation of transcription, DNA-templated
    DNA-templated transcription, initiation
    regulation of metal ion transport
    Gene Properties
    Locus tag: PA2050
    Strand: +
    Entrez Gene ID: 877867
    Accession: NP_250740.1
    GI: 15597246
    Sequence start: 2244492
    Sequence End: 2244998
    Sequence Length: 506
    Gene Sequence:
    >PA2050
    ATGGGCATGGATCAGACACGCAATCGCCTCGTCGGCCTGATGTTCCAGAACGACTATTCCTGGCTGAGCGGGCGCCTGCGGCGCTACCTCGGCTGCCCCCACAGCGCCGAGGACATCGCCTCGGAAACCTTCCTCAAGGTCCTTGCCCTGCCGGACCCGGCAAGCATCCGCGAGCCGCGCGCGCTGCTCACCACCATCGCCCGCCGGCTGATGTACGACGGCTGGCGGCGCCAGGACCTGGAACGCGCCTACCTGGAAAGCCTGGCCGGGCTTCCGGAGGCCCTCGCGCCGTCCGCCGAGGAGCAGGCCCAGGTGGTGGAAACCCTGCTGCGCCTGGAGCGCATGCTCGCCGGGCTGTCGCCGAAGGCCCGCGCCGCCTTCATCCATAGCCAGATCGGCGGACTGACCTACGTGGAGATCGCCTGCTTGCTGGAGGTTTCCGTCAGCCGCATCCACCAGTACATGGTCGAGGGCTTCAAGCAGTGCTACCAGGTGCTTGCCGAATGA
    Protein Properties
    Protein Residues: 168
    Protein Molecular Weight: 19 kDa
    Protein Theoretical pI: 6.78
    Hydropathicity (GRAVY score): -0.084
    Charge at pH 7 (predicted): -0.38
    Protein Sequence:
    >PA2050
    MGMDQTRNRLVGLMFQNDYSWLSGRLRRYLGCPHSAEDIASETFLKVLALPDPASIREPRALLTTIARRLMYDGWRRQDLERAYLESLAGLPEALAPSAEEQAQVVETLLRLERMLAGLSPKARAAFIHSQIGGLTYVEIACLLEVSVSRIHQYMVEGFKQCYQVLAE
    References
    External Links:
    Resource Link
    Genome ID: PA2050
    Entrez Gene ID: 877867
    NCBI Protein ID: 15597246
    General Reference: PaperBLAST - Find papers about PA2050 and its homologs