Identification
Name: ECF sigma factor, FemI
Synonyms: Not Available
Gene Name: femI
Enzyme Class: Not Available
Biological Properties
General Function: DNA-templated transcription, initiation, regulation of transcription, DNA-templated, siderophore transport, cell surface receptor signaling pathway
Specific Function: DNA binding, sequence-specific DNA binding transcription factor activity, sigma factor activity, siderophore uptake transmembrane transporter activity, signaling receptor activity
Cellular Location: Cytoplasmic
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites: Not Available
    GO Classification:
    Function
    DNA binding
    sequence-specific DNA binding transcription factor activity
    sigma factor activity
    siderophore uptake transmembrane transporter activity
    signaling receptor activity
    Process
    DNA-templated transcription, initiation
    regulation of transcription, DNA-templated
    siderophore transport
    cell surface receptor signaling pathway
    Gene Properties
    Locus tag: PA1912
    Strand: -
    Entrez Gene ID: 878255
    Accession: NP_250602.1
    GI: 15597108
    Sequence start: 2085423
    Sequence End: 2085929
    Sequence Length: 506
    Gene Sequence:
    >PA1912
    ATGCCGCCGGCCGACGCCTCCCTGCACGACGCTGTGAGCCATCTCTACCAGGACCACCATGGCTGGCTGCAAGGCTGGTTGCGGCGACGCCTGGGCTGCGCGGAAAACGCCGCCGACCTGGCCCAGGACACCTTCGCCCGCCTGCTCGCCTCGCGCCGGGTACTGGATGCGCGCGAACCGCGCGCCTACCTGACCACCGTCGCCAAGGGGCTGATGATCAACTGGTTCCAGCGCCAGTCGCTGGAGCGCGCCTACCTCGATGCCCTGGCCAACCTCCCGGAAGACCTCGCGCCGCCGCCGGAACAGCGGTTGATGGTGCTGGAAACCCTGCATGAAGTAGACGCCCTGCTCGGCAGCCTGCCGGACAGGGTCCGCCAGGCGTTTCTCCTGGCGCAGATCGAAGGCCTGAAGTACGAAGCCATCGCCGAGCGCCTGGGCGTGTCCCTGGGTTCGGTCAAGCGCTACATGCAGCAGGCCTTCCGCCAGTGCCTGGAGCTGATGGAATGA
    Protein Properties
    Protein Residues: 168
    Protein Molecular Weight: 19.1 kDa
    Protein Theoretical pI: 6.35
    Hydropathicity (GRAVY score): -0.218
    Charge at pH 7 (predicted): -1.87
    Protein Sequence:
    >PA1912
    MPPADASLHDAVSHLYQDHHGWLQGWLRRRLGCAENAADLAQDTFARLLASRRVLDAREPRAYLTTVAKGLMINWFQRQSLERAYLDALANLPEDLAPPPEQRLMVLETLHEVDALLGSLPDRVRQAFLLAQIEGLKYEAIAERLGVSLGSVKRYMQQAFRQCLELME
    References
    External Links:
    Resource Link
    Genome ID: PA1912
    Entrez Gene ID: 878255
    NCBI Protein ID: 15597108
    General Reference: PaperBLAST - Find papers about PA1912 and its homologs