type III export protein PscF (PA1719)
Identification | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|
Name: | type III export protein PscF | |||||||||
Synonyms: | Not Available | |||||||||
Gene Name: | pscF | |||||||||
Enzyme Class: | Not Available | |||||||||
Biological Properties | ||||||||||
General Function: | protein secretion by the type III secretion system, pathogenesis, protein transport, protein secretion by the type III secretion system | |||||||||
Specific Function: | protein transporter activity | |||||||||
Cellular Location: | Extracellular | |||||||||
KEGG Pathways: |
| |||||||||
KEGG Reactions: | Not Available | |||||||||
SMPDB Reactions: | Not Available | |||||||||
PseudoCyc/BioCyc Reactions: |
| |||||||||
Complex Reactions: | Not Available | |||||||||
Transports: | Not Available | |||||||||
Metabolites: | Not Available | |||||||||
GO Classification: |
| |||||||||
Gene Properties | ||||||||||
Locus tag: | PA1719 | |||||||||
Strand: | + | |||||||||
Entrez Gene ID: | 879634 | |||||||||
Accession: | NP_250410.1 | |||||||||
GI: | 15596916 | |||||||||
Sequence start: | 1862764 | |||||||||
Sequence End: | 1863021 | |||||||||
Sequence Length: | 257 | |||||||||
Gene Sequence: |
>PA1719 ATGGCGCAGATATTCAACCCCAACCCGGGGAATACCCTCGATACCGTGGCCAATGCCCTGAAGGAGCAGGCCAACGCAGCGAACAAGGACGTCAACGACGCGATCAAGGCCTTGCAGGGGACCGACAATGCCGACAACCCGGCGCTGCTGGCCGAGCTGCAACACAAGATCAACAAGTGGTCGGTCATCTACAACATCAACTCGACGGTGACCCGTGCGCTGCGCGACCTGATGCAAGGCATCCTGCAGAAGATCTGA | |||||||||
Protein Properties | ||||||||||
Protein Residues: | 85 | |||||||||
Protein Molecular Weight: | 9.3 kDa | |||||||||
Protein Theoretical pI: | 7.54 | |||||||||
Hydropathicity (GRAVY score): | -0.344 | |||||||||
Charge at pH 7 (predicted): | 0.22 | |||||||||
Protein Sequence: |
>PA1719 MAQIFNPNPGNTLDTVANALKEQANAANKDVNDAIKALQGTDNADNPALLAELQHKINKWSVIYNINSTVTRALRDLMQGILQKI | |||||||||
References | ||||||||||
External Links: |
| |||||||||
General Reference: | PaperBLAST - Find papers about PA1719 and its homologs |