Identification
Name: type III export protein PscF
Synonyms: Not Available
Gene Name: pscF
Enzyme Class: Not Available
Biological Properties
General Function: protein secretion by the type III secretion system, pathogenesis, protein transport, protein secretion by the type III secretion system
Specific Function: protein transporter activity
Cellular Location: Extracellular
KEGG Pathways:
    KEGG Reactions: Not Available
    SMPDB Reactions: Not Available
    PseudoCyc/BioCyc Reactions:
    Complex Reactions: Not Available
    Transports: Not Available
    Metabolites: Not Available
    GO Classification:
    Component
    type III protein secretion system complex
    Function
    protein transporter activity
    Process
    protein secretion by the type III secretion system
    pathogenesis
    protein transport
    protein secretion by the type III secretion system
    Gene Properties
    Locus tag: PA1719
    Strand: +
    Entrez Gene ID: 879634
    Accession: NP_250410.1
    GI: 15596916
    Sequence start: 1862764
    Sequence End: 1863021
    Sequence Length: 257
    Gene Sequence:
    >PA1719
    ATGGCGCAGATATTCAACCCCAACCCGGGGAATACCCTCGATACCGTGGCCAATGCCCTGAAGGAGCAGGCCAACGCAGCGAACAAGGACGTCAACGACGCGATCAAGGCCTTGCAGGGGACCGACAATGCCGACAACCCGGCGCTGCTGGCCGAGCTGCAACACAAGATCAACAAGTGGTCGGTCATCTACAACATCAACTCGACGGTGACCCGTGCGCTGCGCGACCTGATGCAAGGCATCCTGCAGAAGATCTGA
    Protein Properties
    Protein Residues: 85
    Protein Molecular Weight: 9.3 kDa
    Protein Theoretical pI: 7.54
    Hydropathicity (GRAVY score): -0.344
    Charge at pH 7 (predicted): 0.22
    Protein Sequence:
    >PA1719
    MAQIFNPNPGNTLDTVANALKEQANAANKDVNDAIKALQGTDNADNPALLAELQHKINKWSVIYNINSTVTRALRDLMQGILQKI
    References
    External Links:
    Resource Link
    Genome ID: PA1719
    Entrez Gene ID: 879634
    NCBI Protein ID: 15596916
    General Reference: PaperBLAST - Find papers about PA1719 and its homologs